Entry information : MguPrx54 (mgv1a010460m)
Entry ID 9223
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-03 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: MguPrx54 (mgv1a010460m)
Name (synonym) MguPrx54 (mgv1a010460m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx54
start..stop
S start..stop
NtPrx06-1B 394 1.36e-138 4..307 9..331
NtPrx06-1A 386 1.21e-135 17..307 22..329
EguPrx126 374 8.21e-131 29..309 27..328
StPrx76 373 2.64e-130 9..307 10..328
Gene structure Fichier Exons


exon

Literature and cross-references MguPrx54 (mgv1a010460m)
DNA ref. Phytozome 12:   scaffold_113 (242253..240577)
Protein sequence: MguPrx54 (mgv1a010460m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (292)
PWM (Da):   %s   34004.72 (31823.5)  
PI (pH):   %s   10.11 (10.08) Peptide Signal:   %s   cut: 20 range:20-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTLLGFVLVFVSLTVVYGAGKKAPVKPGLRLDFYKSTRCPKAEQLVKQVTEARVRKDSTLGAKLIRLHYHDCFVKGCDASILLDTVGTNQSEKDARPNRSLGVLDILALAAREAVSFPF
KRPMWDVLTGRKDGRVSLLSDVTGNLPSPFSNFSTLQNLFSNKKLDINDLVALSGAHTIGVAHCGAFARRLNFTGRNDTDPSLDPSYGEFLKRQCPTPVNSTTTVGMDPNSTLTFDSHYF
SAVNKKQGLFQSDAALITDPTSAGIVTRFQSPSAFFRQFKLSMVKMGAIEVLVGDAGEIRKNCRVINQSIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST