Entry information : MguPrx86 (mgv1a021857m)
Entry ID 9244
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx86 (mgv1a021857m)
Name (synonym) MguPrx86 (mgv1a021857m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx86
start..stop
S start..stop
CroPrx22 489 7.73e-176 4..327 11..333
CsPrx50 484 1.1e-173 14..327 16..328
CclPrx31 483 1.83e-173 14..327 16..328
NtPrx30-1B 483 2.29e-173 1..327 1..330
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9244' 'complement(join(801914..802335,802876..803041,803307..803489,803580..803792))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 803580..803792 211 N° 2 803307..803489 181 N° 3 802876..803041 164 N° 4 801914..802335 420
complement(join(801914..802335,802876..803041,803307..803489,803580..803792))


exon

Literature and cross-references MguPrx86 (mgv1a021857m)
DNA ref. Phytozome 12:   scaffold_92 (803792..801914)
Protein sequence: MguPrx86 (mgv1a021857m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   35152.67 (32140.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.08 (7.22) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQKSYNYNYSRVLMFLMLCVVVRSQLSADFYARSCPNLLNIVRKEVKNAIKNEMRMAASLLRLHFHDCFVNGCDASVLLDGSDGEKFALPNLNSARGYEVIDTIKNAVETSCSGVVSCAD
ILTLAARDSVLLSGGPSWKVVLGRRDGLVGNQTGANSALPSPFESLDNIIAKFAAVGLNVTDVVALSGGHTIGLSRCALFSNRLSNFSGTGAPDSTLNTSLIPELQTACPATGDGNNTVP
LDNRSRDLFDNRYFVNLVNGRGILQSDQILVSSDSAQSTTRSIAQLYSTNATVFFCDFVNSMIKMGNISPLTGSNGQIRKNCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGAAGTCATACAATTATAATTACTCTAGGGTTTTGATGTTTTTAATGTTGTGTGTAGTGGTGAGGTCTCAACTTAGTGCAGATTTTTACGCTAGAAGCTGTCCGAATCTGCTTAAT
ATTGTTCGAAAAGAGGTTAAAAACGCGATAAAGAATGAGATGAGGATGGCTGCTTCTTTGCTTCGACTTCACTTCCATGATTGCTTCGTCAAT
GTGATGAGTAAACTAAATAATTCTACC
ATTAATATTTCTTTTAATTTTATACGAATATTGTAATTTATTTTTCTTTTTTTGTTTAATTAGGGGGATGCGATGCATCGGTGTTGTTGGATGGAAGTGACGGCGAAAAGTTTGCGCTTC
CGAATTTAAACTCAGCAAGAGGATACGAAGTGATCGACACCATAAAAAATGCAGTGGAGACCTCTTGCAGCGGTGTCGTTTCGTGTGCCGATATTCTCACACTAGCTGCTCGAGACTCCG
TGCTCTTG
GTATGTAATTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACCCAATATTGCATATANNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNATACGTTGGAATGCATGCATGCAGAGAGTGGAGGGCCATCATGGAAGGTAGTGTTGGGGAGAAGAGATGGATTAGTGGGTAACCAAACGGGAGCAAATTCAGCACTTCCTT
CTCCGTTTGAATCTCTTGATAATATCATTGCCAAATTTGCTGCCGTTGGTTTAAACGTTACTGACGTCGTTGCTTTATCAG
GTATTTAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTA
ACCCTTGAATATTTTTTGAAGGCGCGGGCACACAATTGGGTTATCAAGATGCGCGCTCTTCAGCAACAGGCTATCCAATTTTTCCGGCACCGGAGCACCGGACAGCACGCTCAACACCAG
CCTGATTCCGGAGCTGCAGACCGCCTGTCCGGCCACCGGCGACGGCAACAACACCGTCCCCCTAGACAACAGATCCAGAGACTTATTCGACAACCGCTACTTCGTCAATTTGGTCAACGG
GAGGGGCATTTTGCAGTCCGATCAAATACTTGTTTCCAGTGACTCAGCTCAGTCAACCACCAGAAGTATTGCCCAACTCTACAGTACAAATGCTACGGTTTTCTTTTGTGACTTCGTGAA
TTCCATGATTAAGATGGGGAATATTAGCCCCTTAACCGGATCAAATGGACAGATTAGAAAGAATTGCAGGGTTGTCAATTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGAAGTCATACAATTATAATTACTCTAGGGTTTTGATGTTTTTAATGTTGTGTGTAGTGGTGAGGTCTCAACTTAGTGCAGATTTTTACGCTAGAAGCTGTCCGAATCTGCTTAAT
ATTGTTCGAAAAGAGGTTAAAAACGCGATAAAGAATGAGATGAGGATGGCTGCTTCTTTGCTTCGACTTCACTTCCATGATTGCTTCGTCAAT
GGATGCGATGCATCGGTGTTGTTGGAT
GGAAGTGACGGCGAAAAGTTTGCGCTTCCGAATTTAAACTCAGCAAGAGGATACGAAGTGATCGACACCATAAAAAATGCAGTGGAGACCTCTTGCAGCGGTGTCGTTTCGTGTGCCGAT
ATTCTCACACTAGCTGCTCGAGACTCCGTGCTCTTG
AGTGGAGGGCCATCATGGAAGGTAGTGTTGGGGAGAAGAGATGGATTAGTGGGTAACCAAACGGGAGCAAATTCAGCACTTCCT
TCTCCGTTTGAATCTCTTGATAATATCATTGCCAAATTTGCTGCCGTTGGTTTAAACGTTACTGACGTCGTTGCTTTATCAG
GCGGGCACACAATTGGGTTATCAAGATGCGCGCTCTTC
AGCAACAGGCTATCCAATTTTTCCGGCACCGGAGCACCGGACAGCACGCTCAACACCAGCCTGATTCCGGAGCTGCAGACCGCCTGTCCGGCCACCGGCGACGGCAACAACACCGTCCCC
CTAGACAACAGATCCAGAGACTTATTCGACAACCGCTACTTCGTCAATTTGGTCAACGGGAGGGGCATTTTGCAGTCCGATCAAATACTTGTTTCCAGTGACTCAGCTCAGTCAACCACC
AGAAGTATTGCCCAACTCTACAGTACAAATGCTACGGTTTTCTTTTGTGACTTCGTGAATTCCATGATTAAGATGGGGAATATTAGCCCCTTAACCGGATCAAATGGACAGATTAGAAAG
AATTGCAGGGTTGTCAATTCTTGA

Retrieve as FASTA