1. Browse the Database
  2. View Redoxidase
Entry information : PpePrx19 (ppa008590m)
Entry ID 9269
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx19 (ppa008590m)
Name (synonym) PpePrx19 (ppa008590m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx19
start..stop		 S start..stop
PpePrx20 614 0 1..327 1..326
GhPrx13 484 4.32e-174 24..326 22..322
CsPrx15 481 5.63e-173 7..327 6..324
CclPrx07 481 7.46e-173 7..326 6..323
Gene structure Fichier Exons►


exon

Literature and cross-references PpePrx19 (ppa008590m)
DNA ref. Phytozome 12:   scaffold_6 (1988018..1991059)
Protein sequence: PpePrx19 (ppa008590m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   35041.88 (32245.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   10.22 (10.22) Peptide Signal:   %s   cut: 28 range:28-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGRSSSVCSIWVIVLLVGFTGSSSAKLSTKFYSKSCPKVFNAVKSVVQSAVHKEKRMGASLLRLHFHDCFVHGCDGSLLLDDTSSFTGEKTASPNNNSLRGFKVVDKIKSQVEKTCPG
VVSCADILAIAARDSVKILGGPSWHVKLGRRDSKTASFFAANRSGVLPSPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGKAQCSSFRDRIYNDTNIDASFAKARQRKCPSTVGSGDNH
LAPLDVQTPNTFDTAYFKNLINQKGLLHSDQVLYNNGGSTDSLVKTYSGSANAFNSDFAKAMIKMGDIKPLTGSNGEIRLNCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST