Entry information : PpePrx21 (ppa008634m)
Entry ID 9271
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx21 (ppa008634m)
Name (synonym) PpePrx21 (ppa008634m)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx21
start..stop
S start..stop
VvPrx82 441 3.96e-157 1..325 1..326
KfedPrx27 391 3.05e-137 1..320 1..321
InPrx14 388 6.62e-136 17..323 32..333
IaquPrx85 386 2.14e-135 17..323 27..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9271' 'complement(join(8729859..8730265,8730390..8730750,8730949..8731155))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8730949..8731155 205 N° 2 8730390..8730750 359 N° 3 8729859..8730265 405  
complement(join(8729859..8730265,8730390..8730750,8730949..8731155))


exon

Literature and cross-references PpePrx21 (ppa008634m)
DNA ref. Phytozome 12:   scaffold_1 (8731155..8729859)
Protein sequence: PpePrx21 (ppa008634m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   34842.7 (32552.5)  
PI (pH):   %s   6.35 (6.65) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDLRAIVVGISLFVFSIGAEGQGLSYNFYENSCPQVEAIVRAALQPIFLADPTAPAALLRLMFHDCQVQGCDASILVDPNENTVSSEMAAGKNFGIRKRESINILKSIVELECPQQVSCS
DILVLTAREAVSASGGPQIKVPLGRRDSSVPPSYKLADSLLPSATIGVDGMLQLFAKKGMTVEESVAIMGAHTLGVTHCLNILNRLSRLDQGGRVEGMAPMFEAFLRINCPQGSLTSNAS
FVLNDPTTLTFDNHYYNNVIRGHGVLRVDAEMVMDPRTALAVKRFAADQDGFFQAFSSAFVKFSSSGVLSGNQGVVRKICNVLD*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCTGAGAGCTATAGTGGTAGGCATATCTCTGTTTGTGTTCAGCATTGGAGCTGAAGGGCAAGGGCTTTCTTATAATTTCTATGAGAACTCATGCCCACAAGTCGAGGCCATTGTT
AGAGCTGCCCTCCAACCTATTTTTCTCGCTGATCCCACTGCTCCTGCAGCTCTGTTGAGGCTCATGTTCCATGATTGCCAAGTTCAG
GTCTTTTTTTTATTTTTCTTTGNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNAGTTTAGGAATTTGAGGCATGGGTTAGTTGAGATATAAGCCCAAATAACGAGGGTGAAGTGCATGGCTTAAAAATAGAAACTCTGCAGTCTATTTTTTATT
AGTTATATTTTTTCAATAAATGATGGTTTGATTTTGTAACAACAGGGGGCTGTGATGCTTCAATTCTTGTGGATCCAAATGAGAACACTGTGTCATCGGAGATGGCTGCAGGGAAAAACT
TTGGTATCAGAAAGAGAGAGTCAATCAACATTCTCAAGTCAATAGTTGAATTAGAATGTCCCCAACAGGTTTCTTGCTCCGACATTCTTGTCTTAACTGCTCGGGAGGCAGTGTCTGCGT
CAGGAGGGCCACAGATAAAGGTTCCTTTGGGAAGAAGAGACTCTTCTGTTCCTCCAAGCTATAAGCTTGCAGATTCTTTGCTTCCTTCTGCCACCATCGGAGTTGATGGCATGCTTCAAC
TATTTGCAAAGAAAGGGATGACAGTCGAAGAATCTGTGGCCATAATGG
GTAACAACAACACGAACTTGTTCTATTGGGTTTCTTCAAAACAGTGCGCATTTTTTGAAAAACCAACCTTTT
TGTTCTTTTTATGAAACTAACATGTCCAAAAACATATTATTGCAATTTGCAGGCGCGCGCACACACTAGGGGTGACACATTGTTTGAACATTCTAAATCGTCTAAGCAGACTTGATCAAG
GTGGGCGTGTAGAAGGCATGGCGCCCATGTTTGAAGCATTCCTAAGGATAAACTGTCCTCAAGGCTCTTTGACATCAAATGCAAGCTTCGTTCTTAATGACCCTACAACACTTACATTCG
ACAACCACTACTACAATAATGTAATTAGAGGCCATGGGGTACTTAGAGTTGATGCTGAAATGGTGATGGACCCGCGCACAGCTCTCGCTGTCAAGAGATTTGCTGCCGATCAGGATGGTT
TCTTTCAGGCATTTTCTTCTGCCTTTGTCAAGTTCTCTAGCTCTGGTGTCCTGAGTGGGAATCAAGGTGTTGTTAGAAAGATATGCAATGTATTGGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCTGAGAGCTATAGTGGTAGGCATATCTCTGTTTGTGTTCAGCATTGGAGCTGAAGGGCAAGGGCTTTCTTATAATTTCTATGAGAACTCATGCCCACAAGTCGAGGCCATTGTT
AGAGCTGCCCTCCAACCTATTTTTCTCGCTGATCCCACTGCTCCTGCAGCTCTGTTGAGGCTCATGTTCCATGATTGCCAAGTTCAG
GGCTGTGATGCTTCAATTCTTGTGGATCCAAAT
GAGAACACTGTGTCATCGGAGATGGCTGCAGGGAAAAACTTTGGTATCAGAAAGAGAGAGTCAATCAACATTCTCAAGTCAATAGTTGAATTAGAATGTCCCCAACAGGTTTCTTGCTCC
GACATTCTTGTCTTAACTGCTCGGGAGGCAGTGTCTGCGTCAGGAGGGCCACAGATAAAGGTTCCTTTGGGAAGAAGAGACTCTTCTGTTCCTCCAAGCTATAAGCTTGCAGATTCTTTG
CTTCCTTCTGCCACCATCGGAGTTGATGGCATGCTTCAACTATTTGCAAAGAAAGGGATGACAGTCGAAGAATCTGTGGCCATAATGG
GCGCGCACACACTAGGGGTGACACATTGTTTG
AACATTCTAAATCGTCTAAGCAGACTTGATCAAGGTGGGCGTGTAGAAGGCATGGCGCCCATGTTTGAAGCATTCCTAAGGATAAACTGTCCTCAAGGCTCTTTGACATCAAATGCAAGC
TTCGTTCTTAATGACCCTACAACACTTACATTCGACAACCACTACTACAATAATGTAATTAGAGGCCATGGGGTACTTAGAGTTGATGCTGAAATGGTGATGGACCCGCGCACAGCTCTC
GCTGTCAAGAGATTTGCTGCCGATCAGGATGGTTTCTTTCAGGCATTTTCTTCTGCCTTTGTCAAGTTCTCTAGCTCTGGTGTCCTGAGTGGGAATCAAGGTGTTGTTAGAAAGATATGC
AATGTATTGGACTGA

Retrieve as FASTA