Entry information : PpePrx24 (ppa008667m)
Entry ID 9273
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx24 (ppa008667m)
Name (synonym) PpePrx24 (ppa008667m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx24
start..stop
S start..stop
CclPrx116 491 1.09e-176 1..323 1..321
NtPrx81-1B 476 5.47e-171 3..323 1..320
GhPrx05 469 4.85e-168 19..323 19..322
NtPrx81-1A 468 5.48e-168 3..323 1..320
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9273' 'complement(join(44057761..44058182,44059119..44059281,44059399..44059581,44059813..44060016))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 44059813..44060016 202 N° 2 44059399..44059581 181 N° 3 44059119..44059281 161 N° 4 44057761..44058182 420
complement(join(44057761..44058182,44059119..44059281,44059399..44059581,4405981 3..44060016))


exon

Literature and cross-references PpePrx24 (ppa008667m)
DNA ref. Phytozome 12:   scaffold_1 (44060016..44057761)
Protein sequence: PpePrx24 (ppa008667m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (302)
PWM (Da):   %s   34620.42 (32362.2)  
PI (pH):   %s   4.81 (5.01) Peptide Signal:   %s   cut: 22 range:22-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALVLAMALAMVLAVAQEVEGQLMVGFYGETCPQAEPIVRNVVREAILSDTNMAPVLLRLHFHDCFVEGCDGSILIENGPSGERHAFGHQGVGGFEVIEKAKAELEAACQGVVSCADIVA
LAARDAIAMAGGPAYEVPTGRRDGVVSNMSLADDMPDVSNSIQQLKVKFMRKGLTEKDLVLLSAAHTIGTTACFFLTKRLYNFFPGGGSDPAINPTLLVELKQKCPQNGDVNVRLPIDQG
SGQAFDLHILQNIRNGFAVLESDAKLNEDAVTRGIMDNYFGFFSNLPFGPSFEADFVEAILKMGQIGVRTGFQGAPRRVCASF*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTGGTTTTGGCTATGGCTTTGGCCATGGTTTTGGCTGTGGCGCAGGAGGTTGAGGGGCAGCTTATGGTAGGTTTCTATGGTGAAACATGCCCCCAAGCCGAGCCCATTGTCCGC
AACGTCGTTAGAGAAGCTATTCTCTCCGATACCAACATGGCACCAGTCTTGCTCAGGCTCCATTTTCACGACTGCTTCGTTGAG
GTCCTCTTCTCTCTTTCTCTCTTATTATTGTTTTTT
ATACAAGTCATATTAAAAAAGAAAGAATCAAACCTAGGATCTAGGGTTCATGAGTAATCTTTGAGCTACAAGCTTCTTGCCTCTCTCATCTTTAACCCTTAACTTCTCTACACACTAATA
AACAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATTTGTAAAGCAGGGGGTTGTGATGGGTCAATTCTGATTGAGAACGGACCAAGCGGTG
AGAGGCATGCATTTGGTCACCAAGGCGTTGGGGGATTTGAAGTGATAGAGAAAGCCAAGGCAGAGTTGGAGGCTGCATGCCAAGGCGTGGTTTCTTGTGCAGATATTGTGGCCTTGGCAG
CTAGAGATGCTATAGCCATG
GTGGGTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTACTTGTACCATATTTATTGATCAC
TTTATCGATATATATAGGCGCTGGTGGACCGGCGTACGAGGTGCCTACCGGCCGGAGAGATGGGGTTGTTTCAAATATGTCTCTGGCAGATGACATGCCGGATGTTAGTAATTCAATCCA
ACAGCTCAAGGTTAAGTTCATGCGCAAGGGCCTTACAGAAAAGGACCTTGTCCTCCTCTCTG
GTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCAAGTCAGGGTGATGGTAAGGTT
TGGTGAAAAACCAAGTTTATGTGACTAATGTTACACGCATGATCAATTCAAGTAATATTCCTGCCTTTAATTAATTAATTAACTAGCCCCTTGGCAATTNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATAGATAACGGGTATTTATT
ATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTAAAGCCTCCGTGCCTGCGAAAAGGC
TTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACCTTTTATTTAACAAGGAAATTTAAAACAATCCTCTACATATTAATTGTATGAGAAACAAAATGAGGAAAATTAC
AAAATCAAATATAGAGTTATTGACAATCATGTCATAAGATTAGCTAAAACTATCTGCCACCATGTTTGCTTCTCTGAGAAAATATGACGTATAGATACTTCGGATACTCGATGTGGTAAA
TGATAAATGTCATGAATAATTGATTTAATGCTCCACGGAACTTGAATTTCTTTGTTACATATAAACTTTATCAAGGAAAAAAAATTGAATTGCAAGAAGGATTGGTTTTCGTTTTGTTGA
AAATAACATACATTTTATTGATATTTTCTTTTTTTCAGCTCTGCTCATACAATAGGGACAACGGCATGCTTCTTTTTGACCAAAAGGCTGTACAACTTCTTTCCAGGAGGGGGATCGGAT
CCAGCAATCAACCCCACTCTCCTCGTCGAACTAAAACAAAAGTGCCCTCAAAACGGCGACGTAAATGTGCGGTTACCCATTGACCAAGGAAGCGGGCAGGCATTTGACCTTCATATTCTG
CAAAATATCAGAAATGGGTTCGCCGTGTTAGAATCCGATGCCAAGCTCAACGAGGACGCAGTGACCAGGGGTATAATGGACAATTACTTTGGTTTCTTCAGTAATCTCCCGTTCGGACCT
TCTTTTGAGGCAGATTTTGTCGAAGCAATTCTAAAGATGGGCCAGATTGGTGTAAGGACAGGTTTCCAGGGTGCGCCTAGGAGAGTTTGTGCTAGCTTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTGGTTTTGGCTATGGCTTTGGCCATGGTTTTGGCTGTGGCGCAGGAGGTTGAGGGGCAGCTTATGGTAGGTTTCTATGGTGAAACATGCCCCCAAGCCGAGCCCATTGTCCGC
AACGTCGTTAGAGAAGCTATTCTCTCCGATACCAACATGGCACCAGTCTTGCTCAGGCTCCATTTTCACGACTGCTTCGTTGAG
GGTTGTGATGGGTCAATTCTGATTGAGAACGGACCA
AGCGGTGAGAGGCATGCATTTGGTCACCAAGGCGTTGGGGGATTTGAAGTGATAGAGAAAGCCAAGGCAGAGTTGGAGGCTGCATGCCAAGGCGTGGTTTCTTGTGCAGATATTGTGGCC
TTGGCAGCTAGAGATGCTATAGCCATG
GCTGGTGGACCGGCGTACGAGGTGCCTACCGGCCGGAGAGATGGGGTTGTTTCAAATATGTCTCTGGCAGATGACATGCCGGATGTTAGTAAT
TCAATCCAACAGCTCAAGGTTAAGTTCATGCGCAAGGGCCTTACAGAAAAGGACCTTGTCCTCCTCTCTG
CTGCTCATACAATAGGGACAACGGCATGCTTCTTTTTGACCAAAAGGCTG
TACAACTTCTTTCCAGGAGGGGGATCGGATCCAGCAATCAACCCCACTCTCCTCGTCGAACTAAAACAAAAGTGCCCTCAAAACGGCGACGTAAATGTGCGGTTACCCATTGACCAAGGA
AGCGGGCAGGCATTTGACCTTCATATTCTGCAAAATATCAGAAATGGGTTCGCCGTGTTAGAATCCGATGCCAAGCTCAACGAGGACGCAGTGACCAGGGGTATAATGGACAATTACTTT
GGTTTCTTCAGTAATCTCCCGTTCGGACCTTCTTTTGAGGCAGATTTTGTCGAAGCAATTCTAAAGATGGGCCAGATTGGTGTAAGGACAGGTTTCCAGGGTGCGCCTAGGAGAGTTTGT
GCTAGCTTTTAG

Retrieve as FASTA