Entry information : PpePrx42 (ppa015245m)
Entry ID 9283
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx42 (ppa015245m)
Name (synonym) PpePrx42 (ppa015245m)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx42
start..stop
S start..stop
VvPrx65 516 0 1..326 1..323
MdPrx10 512 0 10..326 23..341
IaquPrx45 509 0 1..326 3..330
MePrx64 503 0 1..326 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21473616..21473834 219 N° 2 21473943..21474134 192 N° 3 21474268..21474837 570  
join(21473616..21473834,21473943..21474134,21474268..21474837)


exon

Literature and cross-references PpePrx42 (ppa015245m)
DNA ref. Phytozome 12:   scaffold_3 (21473616..21474837)
Protein sequence: PpePrx42 (ppa015245m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   34760.13 (32115.7)  
PI (pH):   %s   4.5 (4.46) Peptide Signal:   %s   cut: 24 range:24-326
Sequence 368
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEACKGLLLLMVVLVLMVMQGRESEGQLAENFYSSTCPNVEFIVKQAVSTKLSQTPITIPATLRLFFHDCFVEGCDASVMIASPNGDAEKDFSDNLSLAGDGFDTVIKAKQAVEALCPGVVSCADILALAARDCVVLAGGPAFSVELGRRDGLVSQASQVVGNLPEPNFNLDQLNTMFAKHNLSQTDVVALSGAHTVGFSHCGRFSDRLYNFSSNSPVDPSLDPGYAKQLMGACPINADQVINLDPETPDTFDNAYYRNLVAGKGLLSSDQVLFSDSASRPTVIDFANNPGNFNGAFITAMRKLGRVGVKTGDQGQIRTDCTTFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (A short 5' end is missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGGCATGTAAAGGGTTGTTGCTGTTAATGGTGGTTTTGGTTTTGATGGTTATGCAGGGGAGGGAATCAGAGGGACAATTAGCAGAAAACTTCTATAGCTCTACTTGTCCAAATGTTG
AATTCATAGTGAAGCAGGCAGTCTCTACAAAACTAAGCCAGACGCCTATCACAATTCCGGCCACTTTGCGACTATTTTTCCATGACTGCTTTGTTGAG
GTAGGTTGCAAGCATTGAAGCA
GGGCAATGGGCATGGTGTTTAAAATGTCACAATATACTCATCCTTTTCTTGGTTAATCAATCTTCAACTTTACAATGAATTTGCAGGGATGCGATGCATCGGTCATGATCGCTTCACCAA
ATGGGGACGCAGAGAAGGACTTCTCGGATAATCTTTCGTTAGCAGGAGATGGATTTGACACCGTCATCAAGGCCAAGCAAGCAGTGGAAGCACTATGCCCCGGTGTCGTTTCTTGTGCTG
ACATTTTGGCTCTCGCTGCCCGGGATTGTGTAGTCCTC
GTAAGTCATACCATGACACTCATGGCTCATGCAAGGCAGATGCACAAACTTAACTCAAAGCTTGTTAACAAATAAAAATCCA
ATCCACTACTTATCTCATGACATATTAATTCCACTTTCAAATTATCTGCAGGCTGGAGGCCCTGCATTCAGCGTAGAATTGGGACGCCGTGATGGACTAGTTTCACAAGCCTCTCAGGTC
GTTGGGAATTTGCCAGAACCAAACTTTAATCTCGATCAGCTAAATACCATGTTCGCCAAACACAATCTTTCCCAAACTGATGTTGTTGCATTATCTGGAGCACATACTGTAGGCTTTTCG
CACTGCGGTCGCTTTTCAGACCGCCTCTACAACTTTTCATCGAACTCTCCTGTGGACCCTTCTTTGGATCCTGGCTATGCCAAGCAGTTGATGGGAGCCTGTCCCATAAATGCAGACCAA
GTTATCAACTTGGACCCTGAAACCCCAGACACTTTTGACAACGCCTATTACAGAAACTTGGTTGCAGGGAAGGGGTTGTTGAGTTCGGATCAGGTTCTTTTCTCTGACTCTGCATCTCGG
CCTACTGTGATTGATTTTGCTAACAACCCTGGTAACTTCAATGGAGCCTTCATCACTGCCATGAGGAAGCTCGGAAGGGTCGGCGTTAAGACTGGTGACCAAGGGCAGATAAGGACAGAC
TGCACCACCTTCAATTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGGCATGTAAAGGGTTGTTGCTGTTAATGGTGGTTTTGGTTTTGATGGTTATGCAGGGGAGGGAATCAGAGGGACAATTAGCAGAAAACTTCTATAGCTCTACTTGTCCAAATGTTG
AATTCATAGTGAAGCAGGCAGTCTCTACAAAACTAAGCCAGACGCCTATCACAATTCCGGCCACTTTGCGACTATTTTTCCATGACTGCTTTGTTGAG
GGATGCGATGCATCGGTCATGA
TCGCTTCACCAAATGGGGACGCAGAGAAGGACTTCTCGGATAATCTTTCGTTAGCAGGAGATGGATTTGACACCGTCATCAAGGCCAAGCAAGCAGTGGAAGCACTATGCCCCGGTGTCG
TTTCTTGTGCTGACATTTTGGCTCTCGCTGCCCGGGATTGTGTAGTCCTC
GCTGGAGGCCCTGCATTCAGCGTAGAATTGGGACGCCGTGATGGACTAGTTTCACAAGCCTCTCAGGTCG
TTGGGAATTTGCCAGAACCAAACTTTAATCTCGATCAGCTAAATACCATGTTCGCCAAACACAATCTTTCCCAAACTGATGTTGTTGCATTATCTGGAGCACATACTGTAGGCTTTTCGC
ACTGCGGTCGCTTTTCAGACCGCCTCTACAACTTTTCATCGAACTCTCCTGTGGACCCTTCTTTGGATCCTGGCTATGCCAAGCAGTTGATGGGAGCCTGTCCCATAAATGCAGACCAAG
TTATCAACTTGGACCCTGAAACCCCAGACACTTTTGACAACGCCTATTACAGAAACTTGGTTGCAGGGAAGGGGTTGTTGAGTTCGGATCAGGTTCTTTTCTCTGACTCTGCATCTCGGC
CTACTGTGATTGATTTTGCTAACAACCCTGGTAACTTCAATGGAGCCTTCATCACTGCCATGAGGAAGCTCGGAAGGGTCGGCGTTAAGACTGGTGACCAAGGGCAGATAAGGACAGACT
GCACCACCTTCAATTCATGA

Retrieve as FASTA