Entry information : PpePrx43 (ppa015551m)
Entry ID 9284
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx43 (ppa015551m)
Name (synonym) PpePrx43 (ppa015551m)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx43
start..stop
S start..stop
PpePrx54 558 0 1..321 1..323
PtPrx39 462 1.11e-165 1..320 1..319
PpePrx55 460 1.15e-164 13..321 19..331
PpePrx57 451 3.99e-161 7..321 13..331
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9284' 'join(1974596..1974808,1974903..1975097,1975249..1975803)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1974596..1974808 211 N° 2 1974903..1975097 193 N° 3 1975249..1975803 553  
join(1974596..1974808,1974903..1975097,1975249..1975803)


exon

Literature and cross-references PpePrx43 (ppa015551m)
DNA ref. Phytozome 12:   scaffold_6 (1974596..1975803)
Protein sequence: PpePrx43 (ppa015551m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (296)
PWM (Da):   %s   34828.88 (32336.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.64 (8.57) Peptide Signal:   %s   cut: 25 range:25-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGLRSLLVCIVVVAATIVIPTSAQLSASFYNRVCPQALPAIRRVVKQAIFREPRIGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTAFPNANSVRGFDVIDDIKNAVDKACKGSVV
SCADILAVAARDSVFLLAGPLYQVQLGRRDARTASLNDANRNLPPPVFSFSQLLSNFQAHGLDLTDLVVLSAAHTIGLARCGTFRARIYNDTNIDPNFAVSARQNCPSSGGDDNTEPLDA
TTRRFDTVYFKSLLQQKGLLHSDQELYKNNGTDSDKLVLKYSRNPFAFARDFSASMIKMGSIKPLTGNDGEVRLNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTCTTCGATCTTTGCTAGTGTGTATTGTAGTGGTAGCTGCCACTATTGTAATTCCAACCTCTGCACAACTAAGTGCTAGTTTCTATAACAGAGTGTGCCCTCAGGCTCTACCA
GCCATCAGAAGAGTCGTCAAGCAGGCCATCTTTCGTGAACCGAGAATCGGAGCCTCTCTGCTGCGCTTGCACTTCCATGACTGCTTTGTTAAT
ATGTAATTAAGCTATTAGTTGATTGTA
TGCATGCATTGCACTTGCAATACATGTACATTAAAATGTAGATGATTTATTTGGCTGATTTGAATACAGGGCTGTGATGGATCGATTTTGCTTGATGACACGTCTAGCTTCACCGGTGAG
AAGACTGCCTTCCCAAATGCGAATTCAGTCAGGGGATTCGATGTGATCGATGACATCAAAAATGCCGTCGACAAAGCTTGCAAAGGCAGCGTGGTCTCATGTGCGGACATATTGGCAGTT
GCAGCTCGTGATTCTGTATTTCTT
TTGTATGTACAATGTTCACCAAATAATGTGTCAGTACGCACATTTTTGTATCTTTCTTAAAAATAAAGGACCCTACGATCACTTTTATCGTTGAAC
ACATATATCCAGATCAAAACCTAACGAAATTCTTGTTTTTGCTTATTTGTGTTTTAGCTGGCAGGGCCTCTTTACCAAGTACAGTTAGGTAGAAGGGATGCAAGAACTGCAAGCTTGAAT
GATGCAAACAGAAACCTTCCACCTCCAGTTTTCAGCTTCTCACAGCTACTCTCTAACTTCCAAGCTCATGGGCTGGACCTAACAGACCTAGTTGTGCTCTCAGCTGCCCACACCATTGGA
CTTGCTCGATGCGGCACCTTCCGAGCCAGGATCTACAATGACACCAACATAGACCCCAACTTTGCAGTCTCTGCCCGACAAAACTGCCCATCAAGTGGAGGCGATGACAACACAGAGCCC
CTGGATGCAACTACGAGGAGATTCGATACCGTCTACTTTAAGTCCTTGCTGCAACAAAAGGGTCTCCTCCATTCCGATCAAGAGCTCTATAAAAATAATGGCACTGATAGTGATAAGCTG
GTGCTGAAATACAGCAGGAACCCATTTGCTTTTGCAAGAGACTTTTCGGCATCCATGATCAAGATGGGTAGCATCAAGCCTCTTACTGGGAATGATGGAGAAGTGAGATTGAACTGCAGG
AAAATCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTCTTCGATCTTTGCTAGTGTGTATTGTAGTGGTAGCTGCCACTATTGTAATTCCAACCTCTGCACAACTAAGTGCTAGTTTCTATAACAGAGTGTGCCCTCAGGCTCTACCA
GCCATCAGAAGAGTCGTCAAGCAGGCCATCTTTCGTGAACCGAGAATCGGAGCCTCTCTGCTGCGCTTGCACTTCCATGACTGCTTTGTTAAT
GGCTGTGATGGATCGATTTTGCTTGAT
GACACGTCTAGCTTCACCGGTGAGAAGACTGCCTTCCCAAATGCGAATTCAGTCAGGGGATTCGATGTGATCGATGACATCAAAAATGCCGTCGACAAAGCTTGCAAAGGCAGCGTGGTC
TCATGTGCGGACATATTGGCAGTTGCAGCTCGTGATTCTGTATTTCTT
CTGGCAGGGCCTCTTTACCAAGTACAGTTAGGTAGAAGGGATGCAAGAACTGCAAGCTTGAATGATGCAAAC
AGAAACCTTCCACCTCCAGTTTTCAGCTTCTCACAGCTACTCTCTAACTTCCAAGCTCATGGGCTGGACCTAACAGACCTAGTTGTGCTCTCAGCTGCCCACACCATTGGACTTGCTCGA
TGCGGCACCTTCCGAGCCAGGATCTACAATGACACCAACATAGACCCCAACTTTGCAGTCTCTGCCCGACAAAACTGCCCATCAAGTGGAGGCGATGACAACACAGAGCCCCTGGATGCA
ACTACGAGGAGATTCGATACCGTCTACTTTAAGTCCTTGCTGCAACAAAAGGGTCTCCTCCATTCCGATCAAGAGCTCTATAAAAATAATGGCACTGATAGTGATAAGCTGGTGCTGAAA
TACAGCAGGAACCCATTTGCTTTTGCAAGAGACTTTTCGGCATCCATGATCAAGATGGGTAGCATCAAGCCTCTTACTGGGAATGATGGAGAAGTGAGATTGAACTGCAGGAAAATCAAT
TAG

Retrieve as FASTA