Entry information : PpePrx46 (ppa016743m)
Entry ID 9286
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx46 (ppa016743m)
Name (synonym) PpePrx46 (ppa016743m)
Class Class III peroxidase    [Orthogroup: Prx101]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx46
start..stop
S start..stop
PpePrx40 473 3.8e-169 14..339 8..335
NnPrx20 315 6.72e-107 18..339 10..337
GmPrx195 299 9.15e-101 38..339 29..328
GmPrx189 298 1.54e-100 38..339 29..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9286' 'complement(join(25065171..25065953,25066044..25066286))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25066044..25066286 241 N° 2 25065171..25065953 781  
complement(join(25065171..25065953,25066044..25066286))


exon

Literature and cross-references PpePrx46 (ppa016743m)
DNA ref. Phytozome 12:   scaffold_1 (25066286..25065171)
Protein sequence: PpePrx46 (ppa016743m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (314)
PWM (Da):   %s   37300.76 (34129.2) Transmb domain:   %s   i5-22o
PI (pH):   %s   5.23 (5.68) Peptide Signal:   %s   cut: 28 range:28-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEMSLATIIFTFTFTFCTIFIIPCSEAAEKGQGNGLHVGFYGIRCPNAEQIVADVVSKAVEADQKLPAAFIRLFSHDCFVKGCDASILLDSTPSHEPVEIQSPANVGIKGLEVIDEIKAR
LEAECPETVSCADILAFAAREAVALAGLPRHKVPAGRRDSRTSRATDVTLPAPATPLNEIIEYFSRRGMTSDEIVVLSGAHSIGAVHCSFFDYRLYNYDQTQAQDPALDRFYAANLSQQC
PAPNTLPEAEAKNRVVDFDPITPLVLDNQYYANLMQGKALLQSDQALVTDPRTKAMVISMAASADSWTQRFVRAMIKMGRINVLTGENGEIRKNCRAFNPL*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATGAGTCTGGCGACAATAATCTTCACCTTCACCTTCACTTTTTGCACCATCTTTATCATTCCTTGTTCGGAGGCAGCTGAGAAAGGCCAAGGCAACGGCTTGCATGTTGGATTT
TATGGAATCAGATGTCCCAATGCGGAGCAAATTGTGGCTGACGTTGTGTCCAAGGCTGTGGAGGCAGACCAAAAGCTCCCCGCTGCCTTTATTCGACTCTTTTCCCATGATTGCTTTGTC
AAG
GTAAGTATTCGGTTATGAGTTGGTGCTTCTAGCATAATTGTTTACGTAAGAATTAATTCATGATTGTCGAAACAATGTGTGTATGTACAGGGGGGTGCGATGCCTCAATTCTGTTGG
ATTCGACGCCCTCTCATGAGCCTGTTGAGATTCAATCACCAGCCAATGTTGGGATCAAAGGTTTGGAAGTCATTGATGAGATCAAGGCCAGGCTAGAGGCAGAGTGTCCAGAAACCGTCT
CTTGCGCTGACATTTTAGCATTTGCTGCTCGGGAAGCCGTGGCTCTCGCCGGCCTACCACGTCACAAAGTCCCCGCAGGCCGTCGCGACAGCCGTACTTCCCGCGCTACTGACGTCACCC
TTCCTGCTCCTGCGACACCTCTCAACGAGATCATAGAGTACTTCAGCAGAAGAGGCATGACTTCTGACGAAATTGTTGTCTTGTCTGGTGCACACTCCATTGGCGCTGTCCACTGCAGCT
TCTTTGATTACAGGCTGTACAATTACGACCAAACTCAAGCCCAAGACCCTGCCCTGGACCGGTTCTATGCTGCTAATCTGTCTCAACAGTGCCCTGCACCCAACACATTGCCTGAAGCCG
AGGCCAAAAACAGGGTTGTTGACTTCGATCCCATAACACCACTCGTCCTGGACAACCAATACTATGCGAACCTGATGCAAGGGAAAGCCTTGCTTCAATCGGATCAGGCTCTGGTTACTG
ATCCTCGCACCAAAGCTATGGTGATAAGCATGGCTGCTAGTGCTGATTCTTGGACTCAAAGATTTGTTAGGGCCATGATTAAGATGGGGAGAATCAATGTTCTCACTGGAGAGAATGGAG
AGATAAGGAAAAACTGCCGGGCCTTTAACCCACTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATGAGTCTGGCGACAATAATCTTCACCTTCACCTTCACTTTTTGCACCATCTTTATCATTCCTTGTTCGGAGGCAGCTGAGAAAGGCCAAGGCAACGGCTTGCATGTTGGATTT
TATGGAATCAGATGTCCCAATGCGGAGCAAATTGTGGCTGACGTTGTGTCCAAGGCTGTGGAGGCAGACCAAAAGCTCCCCGCTGCCTTTATTCGACTCTTTTCCCATGATTGCTTTGTC
AAG
GGGTGCGATGCCTCAATTCTGTTGGATTCGACGCCCTCTCATGAGCCTGTTGAGATTCAATCACCAGCCAATGTTGGGATCAAAGGTTTGGAAGTCATTGATGAGATCAAGGCCAGG
CTAGAGGCAGAGTGTCCAGAAACCGTCTCTTGCGCTGACATTTTAGCATTTGCTGCTCGGGAAGCCGTGGCTCTCGCCGGCCTACCACGTCACAAAGTCCCCGCAGGCCGTCGCGACAGC
CGTACTTCCCGCGCTACTGACGTCACCCTTCCTGCTCCTGCGACACCTCTCAACGAGATCATAGAGTACTTCAGCAGAAGAGGCATGACTTCTGACGAAATTGTTGTCTTGTCTGGTGCA
CACTCCATTGGCGCTGTCCACTGCAGCTTCTTTGATTACAGGCTGTACAATTACGACCAAACTCAAGCCCAAGACCCTGCCCTGGACCGGTTCTATGCTGCTAATCTGTCTCAACAGTGC
CCTGCACCCAACACATTGCCTGAAGCCGAGGCCAAAAACAGGGTTGTTGACTTCGATCCCATAACACCACTCGTCCTGGACAACCAATACTATGCGAACCTGATGCAAGGGAAAGCCTTG
CTTCAATCGGATCAGGCTCTGGTTACTGATCCTCGCACCAAAGCTATGGTGATAAGCATGGCTGCTAGTGCTGATTCTTGGACTCAAAGATTTGTTAGGGCCATGATTAAGATGGGGAGA
ATCAATGTTCTCACTGGAGAGAATGGAGAGATAAGGAAAAACTGCCGGGCCTTTAACCCACTATAG

Retrieve as FASTA