1. Browse the Database
  2. View Redoxidase
Entry information : PpePrx53 (ppa018701m)
Entry ID 9293
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx53 (ppa018701m)
Name (synonym) PpePrx53 (ppa018701m)
Class Class III peroxidase    [Orthogroup: Prx275]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx53
start..stop		 S start..stop
PpePrx57 652 0 1..330 1..331
PpePrx55 580 0 1..330 1..331
PpePrx54 444 3.77e-158 1..330 1..323
PpePrx43 442 1.11e-157 13..330 7..321
Gene structure Fichier Exons►


exon

Literature and cross-references PpePrx53 (ppa018701m)
DNA ref. Phytozome 12:   scaffold_6 (1970960..1968496)
Protein sequence: PpePrx53 (ppa018701m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (308)
PWM (Da):   %s   35845.67 (33490.5) Transmb domain:   %s   o10-32i
PI (pH):   %s   4.76 (4.67) Peptide Signal:   %s   cut: 33 range:22-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAANSHQPVWVLFTTFVVAAAIVLAPATCTAQLTRDFYQQSCPQALQIIRSVVNGAINRETRMGASLLRLHFHDCFVNGCDGSILLDDTDNFTGEKTASANLNSVRGFDVIDEIKATLN
TYCNGNVVSCADILAVAARDSVEIVSPSYSYEVQLGRRDATTAVLNDANRNIPPPTFDFSQLLSIFQSHGLGLQDLILLSGGHTIGLARCTTFRDRIYNDTNIDPEFAASLREGCPANGG
DDNTTPIDSTTTQFDTVYFKSLLQKKGLFHSDQELFKSDGSDSDNLVQHYANSPEDFKVDFGASMIKMGNINPLTGYAGEIRLNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST