Entry information : PpePrx08 (ppa008433m)
Entry ID 9326
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx08 (ppa008433m)
Name (synonym) PpePrx08 (ppa008433m)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx08
start..stop
S start..stop
RcPrx31 501 1.73e-180 1..332 1..335
CpapPrx45 500 4.28e-180 1..332 1..342
MePrx117 490 2.59e-176 1..332 1..333
PtPrx80 489 1.11e-175 1..332 1..337
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9326' 'join(13607416..13607649,13608135..13608326,13608429..13608594,13608748..13609151)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13607416..13607649 232 N° 2 13608135..13608326 190 N° 3 13608429..13608594 164 N° 4 13608748..13609151 402
join(13607416..13607649,13608135..13608326,13608429..13608594,13608748..13609151 )


exon

Literature and cross-references PpePrx08 (ppa008433m)
DNA ref. Phytozome 12:   scaffold_8 (13607416..13609151)
Protein sequence: PpePrx08 (ppa008433m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (307)
PWM (Da):   %s   36337.2 (33427.7) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.11 (6.66) Peptide Signal:   %s   cut: 26 range:26-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTHKIISYFTFSLCLLLSLSPFVHMHPFAYSQLDYNFYDRSCPRL
SMIVRYNLWAAIRNDTRMAASLLRMHFHDCIVN
GCDGSVLLDDTEDFKGEKNALPNRKSLRGFEVIDNIKADVERFCPSTVSCADILTLAAREAVGLAGGPFWPVPLGRRDGTTASEKAVTEQLPSPIEPLENITAKFTSKGLDIKDVVVLSG
GHTLGFAQCFTFKRRLFDFDGSGNPDPTLDSSALTNLRSICPKKDSANSNLAPLDSTNLRFDNAYYTNLVSNTGLLESDQALVKDPNTAAMVNSYSANHFLFSNDFAASMVKLGNVGVLT
GKDGQIRKKCGSV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCACAAAATCATCTCCTACTTCACTTTTTCTTTATGTTTACTCTTGTCTTTGTCTCCCTTTGTTCATATGCATCCATTTGCTTATAGCCAGCTTGATTACAATTTCTACGACAGA
TCATGCCCCCGCTTATCAATGATTGTTAGGTACAATTTGTGGGCAGCAATCAGGAATGACACCAGGATGGCCGCATCCCTTCTTCGGATGCATTTTCACGATTGTATCGTCAAT
ATGTAA
CTGTTCTTTCTTAAACCTTTTCCACATCTTTATCTCCTTTGAAGAATGTTTTAAAGTAAAAATTTCTAATACTGAGTGCTAGACTGTTTACTAGTAGCTTTCTCCTCTACTTTTCACCCT
TTTATTGGTTGCAAAAGAAGACCTAAGACAGCAGATATATTGGATTTACACATGTCTGCAATTCACATTTTCATACAGAGTTAGAAAACTTTAAAAGATATATTGGTTGCAAAGGAAAAT
AGGCATATACAGCTTCCCTCATTTTAGCTGAAATCCTTTGTTCTAAAACCAAACAAATAGCCTGAAGTTGGTCCTAAGCAACTTCAAGAAATCCTCATATCCTAAGCAAGAATATCATGG
AAGTTACAACTTTCTTGTGACAATGTGCAACATGTACTTCCTAATAATTTATTCTGCAGAAGCCTTTACTAGAAACTCTGTGTTGACACAAGGTGTTATATCCAATGTTGTTGTTTTGTA
GGGGTGTGACGGCTCAGTGCTTCTTGATGACACAGAAGACTTTAAGGGCGAGAAGAATGCATTGCCAAATCGTAAGTCACTTCGGGGTTTCGAAGTGATTGACAATATAAAGGCAGATGT
TGAGAGATTTTGCCCATCGACTGTTTCGTGTGCTGATATTTTGACTCTTGCAGCAAGAGAAGCTGTTGGCCTG
TGGTATACTTGACAGATTTCTATATATTATGGCCAAGTTACCAAATT
GGTTGTTTCTCTTTGCAGTCTTTCTAGTCTCACTTTCATTCCATTATTCTGGTTTAGGCAGGAGGGCCTTTTTGGCCTGTTCCATTGGGCAGAAGAGATGGAACAACTGCAAGTGAGAAG
GCAGTTACTGAACAACTACCATCACCTATTGAGCCTTTAGAGAATATCACTGCCAAGTTCACATCAAAGGGTCTTGACATAAAAGATGTTGTAGTCCTCTCAG
AGGTTCTTGTTTTTCAC
TTTCTTCCCACCAAAACCATCCCTTTTTTTTTTTTTCCCTTCTCTTTTGGGTTTAGTCATTCTCCAAAGTTTTAAAGCCTAAAGTAATGATCCTAATATTCTTGACATGAACATCTTTCT
TGCTTTTGTTTCTTGAAGGTGGACATACTCTAGGATTTGCTCAATGCTTCACCTTCAAGAGAAGACTCTTCGACTTCGACGGCTCTGGCAATCCTGACCCAACACTTGATTCTTCAGCCC
TTACAAACTTGAGAAGCATATGTCCCAAAAAAGATTCAGCAAACAGCAATCTTGCTCCTCTTGATTCCACTAATCTCAGATTTGACAATGCCTATTACACAAACCTGGTTAGCAACACAG
GTCTTCTAGAATCTGATCAGGCATTGGTAAAGGATCCAAATACTGCTGCAATGGTTAATTCTTATAGTGCAAACCATTTTCTTTTCTCTAATGACTTTGCTGCATCAATGGTGAAGCTTG
GTAATGTTGGAGTATTGACTGGGAAAGATGGGCAAATAAGGAAGAAATGTGGATCTGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCACAAAATCATCTCCTACTTCACTTTTTCTTTATGTTTACTCTTGTCTTTGTCTCCCTTTGTTCATATGCATCCATTTGCTTATAGCCAGCTTGATTACAATTTCTACGACAGA
TCATGCCCCCGCTTATCAATGATTGTTAGGTACAATTTGTGGGCAGCAATCAGGAATGACACCAGGATGGCCGCATCCCTTCTTCGGATGCATTTTCACGATTGTATCGTCAAT
GGGTGT
GACGGCTCAGTGCTTCTTGATGACACAGAAGACTTTAAGGGCGAGAAGAATGCATTGCCAAATCGTAAGTCACTTCGGGGTTTCGAAGTGATTGACAATATAAAGGCAGATGTTGAGAGA
TTTTGCCCATCGACTGTTTCGTGTGCTGATATTTTGACTCTTGCAGCAAGAGAAGCTGTTGGCCTG
GCAGGAGGGCCTTTTTGGCCTGTTCCATTGGGCAGAAGAGATGGAACAACTGCA
AGTGAGAAGGCAGTTACTGAACAACTACCATCACCTATTGAGCCTTTAGAGAATATCACTGCCAAGTTCACATCAAAGGGTCTTGACATAAAAGATGTTGTAGTCCTCTCAG
GTGGACAT
ACTCTAGGATTTGCTCAATGCTTCACCTTCAAGAGAAGACTCTTCGACTTCGACGGCTCTGGCAATCCTGACCCAACACTTGATTCTTCAGCCCTTACAAACTTGAGAAGCATATGTCCC
AAAAAAGATTCAGCAAACAGCAATCTTGCTCCTCTTGATTCCACTAATCTCAGATTTGACAATGCCTATTACACAAACCTGGTTAGCAACACAGGTCTTCTAGAATCTGATCAGGCATTG
GTAAAGGATCCAAATACTGCTGCAATGGTTAATTCTTATAGTGCAAACCATTTTCTTTTCTCTAATGACTTTGCTGCATCAATGGTGAAGCTTGGTAATGTTGGAGTATTGACTGGGAAA
GATGGGCAAATAAGGAAGAAATGTGGATCTGTGAAC

Retrieve as FASTA