Entry information : RcAPx07 (29908.m006080)
Entry ID 9333
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: RcAPx07 (29908.m006080)
Name (synonym) RcAPx07 (29908.m006080)
Class Ascorbate peroxidase     [Orthogroup: APx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcAPx07
start..stop
S start..stop
MeAPx02 439 2e-157 3..237 114..349
PtAPx10 432 2e-154 3..237 112..347
VvAPx07 430 7e-154 3..237 109..344
CclAPx01 429 3e-153 3..237 114..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1500635..1500688 54 N° 2 1500464..1500504 41 N° 3 1500029..1500152 124 N° 4 1499797..1499906 110
N° 5 1499322..1499459 138 N° 6 1498524..1498658 135 N° 7 1498295..1498402 108  
complement(join(1498295..1498402,1498524..1498658,1499322..1499459,1499797..1499 906,1500029..1500152,1500464..1500504,1500635..1500688))


exon

Literature and cross-references RcAPx07 (29908.m006080)
DNA ref. Phytozome 12:   29908 (1500688..1498295)
Protein sequence: RcAPx07 (29908.m006080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   25679.83  
PI (pH):   %s   4.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCPINTNLALNDAMTYDKASKSGGPNGSIRFSSEISRPENEGLAAALNMLEEAKEEIDSYSxGGPISFADLIQSAQSAVKSTFLASAIRKCGGNEEKGTLLYSAYGSNGQWGLFDKQFGRSDTQEPDPEGRVPQWEKATVQEMKDKFKAIGFGPRQLAVMSAFIGPDQAATEALLATDPDVLPWVQKYQRSRETVSQTDYEVDLITTLTKLSSLGQQINYEAYTYPVLKIDVTKLKL

Retrieve as FASTA  
Remarks Partial sequence fro genomic. Incorrect prediction from phytozome (5' end is missing which has not been found yet).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTGTCCCATCAATACTAACTTGGCACTAAATGATGCCATGACTTATGATAAGGTCAGACCTGAAACTCTACCTGTTAAAATATTTATCTTCAGGTTATGGAAGTCCTTTACTTTCTGTA
TAAGAGAAAAAGCGAACAAATCTATATATATATATATATACACTGATTTCTTTCTGATTGCAGGCTTCCAAATCTGGGGGCCCAAATGGATCCATACGTTTCAGGTATCTACTACATGAA
GTATTACTCTCATATGATTTGGAACAATAATTAGTTGGAAGTATGAATGACGATATCGGATTTGTGCATATTTTTACTGTTACAAAGCCTCACAACTTGCGGTTTTTCTGAAGTAACTTG
ATAGTATGAAGAGATTTCAATTCATGCTTGTTTTCTAGCTTTTCAAAGTTCATTATAATACATGCTTTTCTCCTTTGACTTATCAACTAATTCATTTTATGCAATTTTGAAGAATTATCC
TTCTTTCTTTTTCAACAGCTATCTTAATTTTCTTGTCTTTCTTTCCTGCTTGAAGTTCAGAGATAAGCAGACCTGAAAACGAGGGACTTGCTGCAGCTTTGAATATGTTAGAGGAAGCAA
AGGAGGAGATAGATTCATATTCGAANGGTGGACCCATCTCCTTTGCAGATCTTATCCAAT
GTGCAGGTCTACATGTTAAATCCACCAAGTTTCAGACTGCTGCATGTATGGCCATTTGCA
GGAGCTATTATATGCAGATAATCAAAATATAATTTGTCTAATTCAATGTTCTTCGTTTTTAGCAGCACAAAGCGCGGTTAAGTCTACATTTCTAGCTTCTGCCATCCGCAAGTGTGGAGG
TAATGAAGAGAAAGGAACATTATTGTACTCTGCGTATGGCTCAAATGGACAG
GTTAGTTTTTCTGGTTTGGTTGCCTTGACCTGCAGTTTATTGACCTGTCTCAGAATATAAAAATAAGA
TAGAGCAACTCTCCCTTTCATTTAGCTAATTATTAATATCAGAACCAGAAAAACCGGTCCTGAATTTTTCTTACAAAATTTCAAAATAGAGAAACTGTTTTTCATGTAATAAGTCATAAC
ATGGAATTTTTCACATGTACAAATAATTCTATAAAAGGATTCAAGGGGAAATCCAGAAGAAGAAAGCAAAATAAATCAATAGCATGATGTATGCTTGGAATTAGAAGCAACTTGTTAACA
TGTGATGCATGCGTTGTTTGTTGACGCAGTGGGGACTGTTTGATAAGCAATTTGGACGGTCAGATACCCAGGAGCCAGATCCAGAGGGAAGGGTTCCTCAATGGGAAAAAGCAACTGTAC
AGGAAATGAAAGACAAGTTTAAAGCTATCGGCTTTGGTCCCCGCCAG
GTATCTTCTTCTTCTCATTCACCATAGCAATTGCCCCTTTAGGCTTTGGTGTATTGATGATATTCTCTCATAA
ATTATAGGAGCCTGAACTTTTGTGCGTGTATCCTTTTCTGATTTATTGAAATGATTTGACAATCGTTAGTTTCTGCACTAGTAAAAAATGATGCTTCAGAGACTAGTTGCATGAACAAGT
CATGATTTGATTTAACACTAAATTTAGGCATATAAACTAACTTCTGTTAGTACAGTTCCTCAGCAGAGCTATGTAAGTTCGTGGGATTTAACTCTTCGAGAAGCTTTCTATTTCTCTTGC
CTCCTATTCTGCATTCAGCTTGCGCCTCTTCTGATTACTTCTGTATTATTTCTCTTGTCCATTTCGTCTTCTTTGTTTTGTTTTAGATTGCCTTGTATCAACTATAGGCTGCTGTTATCT
AGATGCTCATAGTTCAATGGTAATTTAAGAAATTCAAGTTTACATTTGATGGATAGTCAGAATGGTGAAGCAAGAAGAGTTTGAAACCGCACATTCAGTAAATTCACTGAAGACTTGCTC
ATATCTTAACCCAAAAAATCACTTGAAGGAATTTCTTATGTTCTATATATAGAATGTAACATATATTGTTCACTGATACAAGTGTGTTTTTTCTTTTTATGGATGGCCAGCTAGCTGTTA
TGTCTGCATTCATTGGTCCAGATCAAGCAGCTACTGAGGCCTTACTGGCCACTGACCCAGATGTTTTGCCATGGGTTCAGAAGTACCAGCGTAGTCGAGAAACTGTCTCTCAGACAGATT
ATGAG
GTTAGTACTTCAAAGTGAGCAAAGATCAAAGTCTGAAATTCGAGATTTATGATTCTTGGGCATATCTATATATTGCTTTGCTTTTCTTATTTTTATAGTACCTAAATTGATTCAA
TTTCAGGTTGACCTGATAACTACTCTCACCAAATTAAGTTCCTTGGGCCAACAAATCAATTATGAAGCATACACATATCCTGTCCTAAAGATAGATGTGACCAAACTCAAATTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTGTCCCATCAATACTAACTTGGCACTAAATGATGCCATGACTTATGATAAGGCTTCCAAATCTGGGGGCCCAAATGGATCCATACGTTTCAGGTCAGAGATAAGCAGACCTGAAAACG
AGGGACTTGCTGCAGCTTTGAATATGTTAGAGGAAGCAAAGGAGGAGATAGATTCATATTCGAANGGTGGACCCATCTCCTTTGCAGATCTTATCCAAT
CAGCACAAAGCGCGGTTAAGT
CTACATTTCTAGCTTCTGCCATCCGCAAGTGTGGAGGTAATGAAGAGAAAGGAACATTATTGTACTCTGCGTATGGCTCAAATGGACAG
TGGGGACTGTTTGATAAGCAATTTGGACGGT
CAGATACCCAGGAGCCAGATCCAGAGGGAAGGGTTCCTCAATGGGAAAAAGCAACTGTACAGGAAATGAAAGACAAGTTTAAAGCTATCGGCTTTGGTCCCCGCCAG
CTAGCTGTTATGT
CTGCATTCATTGGTCCAGATCAAGCAGCTACTGAGGCCTTACTGGCCACTGACCCAGATGTTTTGCCATGGGTTCAGAAGTACCAGCGTAGTCGAGAAACTGTCTCTCAGACAGATTATG
AG
GTTGACCTGATAACTACTCTCACCAAATTAAGTTCCTTGGGCCAACAAATCAATTATGAAGCATACACATATCCTGTCCTAAAGATAGATGTGACCAAACTCAAATTA

Retrieve as FASTA