Entry information : RcPrx02 (27446.m000492)
Entry ID 9334
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx02 (27446.m000492)
Name (synonym) RcPrx02 (27446.m000492)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx02
start..stop
S start..stop
MePrx80 572 0 1..331 1..334
MePrx89 572 0 1..331 1..334
RcPrx04 533 0 8..331 2..329
MePrx141 531 0 1..331 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 127986..128216 231 N° 2 128306..129067 762  
join(127986..128216,128306..129067)


exon

Literature and cross-references RcPrx02 (27446.m000492)
DNA ref. Phytozome 12:   27446 (127986..129067)
Protein sequence: RcPrx02 (27446.m000492)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (301)
PWM (Da):   %s   35679.65 (32522.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.49 (8.57) Peptide Signal:   %s   cut: 31 range:31-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSSTSHSFSSLTITIMFLLLCLLATLSSASLSVGFYRSSCPSAEAIVRRAVNKLVSRNPGLGAGLIRMHFHDCFVRGCDASVLLDSTPGNPSEREHVANNPSLRGFEVINEAKAQIESICPKTVSCADILAFAARDSSFKLGGINYAVPAGRRDGRVSNVDEVAQNLPPFFFNAQQLTDNFARKGMSADEMVTLSGAHSIGISHCSSFSGRLYSFNATYPQDPSMDPRYAAFLKTKCPPPSNNGDPTVPLDPTPNRMDNKYYIELTRNRGLLTSDQTLMNSPSTQRMVVNNARNGATWAAKFAKAMVHMGSLDVLTGTQGEIRTQCSVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTAGCACTAGTCATAGTTTCAGCTCCCTGACCATTACCATTATGTTTCTTTTACTTTGCTTGCTGGCTACATTATCGTCAGCTTCTCTTAGCGTTGGTTTCTATAGATCTTCT
TGTCCATCAGCAGAAGCTATTGTCAGAAGAGCTGTAAACAAATTGGTTTCTCGCAATCCAGGGTTAGGTGCTGGTCTTATTAGGATGCATTTCCATGATTGTTTTGTGAGG
GTATGTATG
TCAACTACTTTGATAGTTCTTGCGTATGGTTTTTACCTTTCTTTATTTTAATCTGATTATTTTTTTTATGTGTTTTACAGGGTTGTGATGCCTCTGTGCTTCTAGATTCTACACCGGGGA
ACCCATCAGAGAGAGAGCATGTAGCTAATAATCCTAGCTTACGAGGTTTTGAGGTGATTAACGAAGCCAAAGCCCAAATTGAATCTATATGTCCGAAAACGGTGTCATGCGCAGACATTC
TTGCATTCGCTGCTCGTGACAGTTCCTTCAAACTTGGAGGGATAAACTACGCTGTGCCAGCAGGAAGGCGAGATGGACGTGTGTCCAATGTGGATGAAGTAGCACAAAATCTCCCTCCAT
TCTTCTTCAATGCACAGCAATTAACAGACAACTTCGCACGTAAAGGAATGTCAGCGGATGAGATGGTGACGCTATCGGGAGCACACTCTATTGGCATCTCACATTGTTCTTCATTCTCTG
GCCGTCTCTACTCTTTCAACGCCACTTATCCTCAGGATCCCTCCATGGACCCTAGATACGCAGCTTTCTTGAAGACAAAGTGCCCACCACCAAGTAACAATGGCGATCCAACTGTACCAC
TTGATCCTACTCCCAATCGTATGGACAACAAATACTACATTGAGTTGACCAGGAATCGAGGATTATTGACTTCCGATCAGACACTGATGAACAGCCCTTCCACACAAAGGATGGTGGTCA
ACAATGCAAGGAATGGCGCCACATGGGCTGCCAAGTTCGCAAAGGCAATGGTGCATATGGGTTCTCTTGATGTTCTTACTGGAACTCAAGGTGAAATTAGGACCCAATGCAGTGTTGTCA
AT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTAGCACTAGTCATAGTTTCAGCTCCCTGACCATTACCATTATGTTTCTTTTACTTTGCTTGCTGGCTACATTATCGTCAGCTTCTCTTAGCGTTGGTTTCTATAGATCTTCT
TGTCCATCAGCAGAAGCTATTGTCAGAAGAGCTGTAAACAAATTGGTTTCTCGCAATCCAGGGTTAGGTGCTGGTCTTATTAGGATGCATTTCCATGATTGTTTTGTGAGG
GGTTGTGAT
GCCTCTGTGCTTCTAGATTCTACACCGGGGAACCCATCAGAGAGAGAGCATGTAGCTAATAATCCTAGCTTACGAGGTTTTGAGGTGATTAACGAAGCCAAAGCCCAAATTGAATCTATA
TGTCCGAAAACGGTGTCATGCGCAGACATTCTTGCATTCGCTGCTCGTGACAGTTCCTTCAAACTTGGAGGGATAAACTACGCTGTGCCAGCAGGAAGGCGAGATGGACGTGTGTCCAAT
GTGGATGAAGTAGCACAAAATCTCCCTCCATTCTTCTTCAATGCACAGCAATTAACAGACAACTTCGCACGTAAAGGAATGTCAGCGGATGAGATGGTGACGCTATCGGGAGCACACTCT
ATTGGCATCTCACATTGTTCTTCATTCTCTGGCCGTCTCTACTCTTTCAACGCCACTTATCCTCAGGATCCCTCCATGGACCCTAGATACGCAGCTTTCTTGAAGACAAAGTGCCCACCA
CCAAGTAACAATGGCGATCCAACTGTACCACTTGATCCTACTCCCAATCGTATGGACAACAAATACTACATTGAGTTGACCAGGAATCGAGGATTATTGACTTCCGATCAGACACTGATG
AACAGCCCTTCCACACAAAGGATGGTGGTCAACAATGCAAGGAATGGCGCCACATGGGCTGCCAAGTTCGCAAAGGCAATGGTGCATATGGGTTCTCTTGATGTTCTTACTGGAACTCAA
GGTGAAATTAGGACCCAATGCAGTGTTGTCAAT

Retrieve as FASTA