Entry information : RcPrx03 (27446.m000493)
Entry ID 9335
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2012-01-03 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: RcPrx03 (27446.m000493)
Name (synonym) RcPrx03 (27446.m000493)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx03
start..stop
S start..stop
RcPrx02 474 9.72e-171 41..291 81..331
MePrx89 438 2.93e-156 10..291 14..334
MePrx80 433 2.26e-154 10..291 14..334
MePrx141 419 9.31e-149 1..291 1..335
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9335' 'join(132059..132157,132175..132882)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 132059..132157 97 N° 2 132175..132882 706  
join(132059..132157,132175..132882)


exon

Literature and cross-references RcPrx03 (27446.m000493)
DNA ref. Phytozome 12:   27446 (132059..132882)
Protein sequence: RcPrx03 (27446.m000493)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   291 (265)
PWM (Da):   %s   31566.67 (28788.3) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.47 (7.54) Peptide Signal:   %s   cut: 27 range:27-291
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSDRILSYSCIAFLLFCSLATLASASLTVGFYMDGKLQLAVLIPEETPRVLPLDRHVANNPSLRGFEVINEAKAQLEAICPQTVSCADILAFAARDSSFKLGGINYAVPAGRRDGHVSN
VDEVAQNLPPFFFNAQQLADNFARKGMSADEMVTLSGAHSIGISHCSSFSGRLYSFNATHPQDPSMDPRYAAFLKTKCPPPNNNGDPTVPLDPTPNRMDNKYYVELTRNRGLLISDQTLM
NSPSTQRMVVNNARNGATWAAKFAKAMVHMGSLDVLTGTQGEIRNQCHVVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (A long sequence in frame is missing which has not been found yet).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTGATAGAATATTGTCATATTCTTGCATTGCTTTCCTTTTGTTTTGCTCATTGGCTACTTTGGCATCTGCATCCCTTACAGTTGGTTTTTACACCANNNNNNNNNNNNNAGAG
ACATGTAGCAAATAATCCTAGCTTACGGGGTTTCGAAGTGATTAATGAAGCTAAAGCCCAACTTGAAGCCATTTGTCCACAAACTGTATCATGCGCAGACATTCTTGCATTCGCTGCTCG
TGACAGTTCCTTCAAGCTTGGAGGGATAAACTACGCTGTGCCAGCAGGAAGGCGAGATGGACATGTTTCAAATGTAGATGAAGTAGCACAAAATCTTCCTCCATTCTTCTTCAATGCACA
GCAATTAGCAGACAATTTCGCACGTAAAGGAATGTCAGCCGATGAGATGGTGACGCTATCAGGAGCACACTCTATTGGCATCTCACATTGTTCTTCATTCTCTGGCCGCCTCTACTCTTT
CAACGCCACTCATCCTCAAGATCCCTCCATGGACCCAAGATACGCAGCTTTCTTAAAGACTAAGTGCCCACCACCTAATAACAATGGTGACCCAACTGTACCACTTGATCCTACTCCTAA
TCGTATGGACAACAAATACTACGTTGAGTTGACCAGGAATCGCGGATTATTGATTTCCGACCAGACACTGATGAACAGCCCGTCCACACAAAGGATGGTGGTGAACAATGCAAGGAACGG
TGCAACTTGGGCTGCCAAGTTCGCAAAGGCAATGGTGCATATGGGGTCCCTTGATGTTCTTACAGGAACTCAAGGTGAAATCAGGAATCAATGCCACGTGGTGAAT

Retrieve as FASTA