Entry information : RcPrx04 (27446.m000494)
Entry ID 9336
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx04 (27446.m000494)
Name (synonym) RcPrx04 (27446.m000494)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx04
start..stop
S start..stop
RcPrx02 518 0 22..329 28..331
MePrx89 515 0 6..329 12..334
MePrx80 515 0 5..329 11..334
MePrx141 476 1e-170 6..329 12..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 134343..134555 213 N° 2 134665..135438 774  
join(134343..134555,134665..135438)


exon

Literature and cross-references RcPrx04 (27446.m000494)
DNA ref. Phytozome 12:   27446 (134343..135438)
Protein sequence: RcPrx04 (27446.m000494)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (305)
PWM (Da):   %s   35199.65 (32752.5) Transmb domain:   %s   i9-31o
PI (pH):   %s   8.4 (8.72) Peptide Signal:   %s   cut: 25 range:25-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSETMSSCVVLVLFCSLATLSSASLRVGFYKSSCPSAEAIVRKTVKKFVSINPGLAAGLIRMHFHDCFVRGCDASVLLQSTPGNPSEREHIANNPSLRGFEVIDEAKAKLEAVCPKTVSCADILAFAARDSSYKLGGVNYAVPAGRRDGLVSNMAEVAQNLPPPSSNAEKLADSFSRKGLSEDELVTLSGAHSVGISRCSSFSNRLYSFNATHAQDPSMDPKYAAFLKTKCPPPNPIYEAKVDPTVGLDPTPNRLDNKYYVQLSNDRGLLNSDQTLMKSPFTQKMVLDNAKSGAAWTAKFAKAMVHMGSIDVLTGPQGEIRTQCSVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGAAACAATGTCCTCTTGCGTTGTCCTCGTGCTGTTTTGTTCATTGGCTACTTTGTCGTCAGCATCCCTTAGAGTGGGGTTTTACAAATCTTCTTGTCCATCAGCAGAAGCT
ATCGTAAGGAAAACTGTAAAGAAATTTGTGTCTATCAATCCAGGGTTAGCTGCTGGTCTAATCAGAATGCATTTTCATGACTGCTTTGTCAGG
GTATGTATTCGCATAATCATGTATATT
CTGATTGTTGTTTGTTGTTATTATTACTCTTGCTGATCTGAGTAATATATGATTAATCTTCCTTTCTCTGTTTCAAATACAGGGTTGTGATGCTTCTGTCCTGCTACAATCAACACCAGG
GAATCCATCAGAAAGAGAACATATTGCTAACAATCCTAGCTTACGAGGTTTTGAGGTGATTGATGAAGCCAAGGCTAAACTTGAAGCTGTATGTCCAAAAACTGTATCATGCGCAGACAT
TCTTGCCTTCGCAGCTCGCGACAGTTCCTATAAGCTTGGAGGAGTAAATTACGCCGTGCCAGCAGGGCGTCGGGATGGGCTTGTGTCCAATATGGCTGAAGTAGCACAAAATCTTCCTCC
TCCCTCCTCCAATGCAGAGAAATTAGCAGACAGTTTCTCCCGTAAAGGATTGTCGGAAGATGAGCTGGTGACACTATCAGGAGCACATTCTGTTGGCATCTCACGTTGTTCTTCATTCTC
TAATCGTCTCTACTCTTTCAATGCTACTCATGCTCAGGATCCTTCCATGGACCCTAAATATGCAGCTTTTCTGAAGACTAAGTGCCCACCACCAAATCCAATTTATGAAGCTAAAGTAGA
TCCGACTGTGGGACTTGACCCTACACCTAATCGCTTAGACAACAAATACTACGTTCAGTTGTCAAATGATCGTGGACTGTTGAATTCAGATCAGACATTGATGAAAAGCCCTTTTACACA
GAAGATGGTATTGGACAATGCAAAGAGTGGTGCAGCATGGACTGCCAAGTTTGCCAAGGCAATGGTGCACATGGGTTCCATTGATGTTCTTACAGGACCTCAAGGTGAAATCAGGACCCA
ATGTAGTGTTGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGAAACAATGTCCTCTTGCGTTGTCCTCGTGCTGTTTTGTTCATTGGCTACTTTGTCGTCAGCATCCCTTAGAGTGGGGTTTTACAAATCTTCTTGTCCATCAGCAGAAGCT
ATCGTAAGGAAAACTGTAAAGAAATTTGTGTCTATCAATCCAGGGTTAGCTGCTGGTCTAATCAGAATGCATTTTCATGACTGCTTTGTCAGG
GGTTGTGATGCTTCTGTCCTGCTACAA
TCAACACCAGGGAATCCATCAGAAAGAGAACATATTGCTAACAATCCTAGCTTACGAGGTTTTGAGGTGATTGATGAAGCCAAGGCTAAACTTGAAGCTGTATGTCCAAAAACTGTATCA
TGCGCAGACATTCTTGCCTTCGCAGCTCGCGACAGTTCCTATAAGCTTGGAGGAGTAAATTACGCCGTGCCAGCAGGGCGTCGGGATGGGCTTGTGTCCAATATGGCTGAAGTAGCACAA
AATCTTCCTCCTCCCTCCTCCAATGCAGAGAAATTAGCAGACAGTTTCTCCCGTAAAGGATTGTCGGAAGATGAGCTGGTGACACTATCAGGAGCACATTCTGTTGGCATCTCACGTTGT
TCTTCATTCTCTAATCGTCTCTACTCTTTCAATGCTACTCATGCTCAGGATCCTTCCATGGACCCTAAATATGCAGCTTTTCTGAAGACTAAGTGCCCACCACCAAATCCAATTTATGAA
GCTAAAGTAGATCCGACTGTGGGACTTGACCCTACACCTAATCGCTTAGACAACAAATACTACGTTCAGTTGTCAAATGATCGTGGACTGTTGAATTCAGATCAGACATTGATGAAAAGC
CCTTTTACACAGAAGATGGTATTGGACAATGCAAAGAGTGGTGCAGCATGGACTGCCAAGTTTGCCAAGGCAATGGTGCACATGGGTTCCATTGATGTTCTTACAGGACCTCAAGGTGAA
ATCAGGACCCAATGTAGTGTTGTGAAT

Retrieve as FASTA