Entry information : RcPrx08 (28295.m000014)
Entry ID 9339
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx08 (28295.m000014)
Name (synonym) RcPrx08 (28295.m000014)
Class Class III peroxidase     [Orthogroup: Prx006]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx08
start..stop
S start..stop
CpapPrx03 291 1e-99 1..207 141..347
HbPrx01 286 1e-97 1..207 139..346
CpapPrx05 283 2e-96 1..207 141..347
RcPrx12 280 2e-96 1..207 65..271
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7109..7277 169 N° 2 8079..8530 452  
join(7109..7277,8079..8530)


exon

Literature and cross-references RcPrx08 (28295.m000014)
DNA ref. Phytozome 12:   28295 (7109..8530)
Protein sequence: RcPrx08 (28295.m000014)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   207
PWM (Da):   %s   21994.85  
PI (pH):   %s   4.29
Sequence 248
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SGGPSWTNQLGRRDARTASRAQANLSLPSPFETLDQLKQKFLDVGLNDNVDLVALSGGHTFGRAQCFTFSQRLVDFNGTGAPDTSLNTTYGDTLRALCPVNGTPSVLTDLDSATPDAFDNRYFSNLLSGKGLLQSDQELFSTPGADTAGIVTNFSTSQTAFFESFVVSMIRMGNLSVLTGTDGEVRLNCRVVNPPLAEDDNLLVSSM

Retrieve as FASTA  
Remarks Patial sequence from genomic. Incorrect prediction from phytozome (Long 5' end is missing due to NNNNN in NDA and short 3' end is missing which has been completed manully).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGGAGGTCCTTCATGGACTAATCAACTAGGAAGAAGAGATGCCAGAACAGCAAGCAGAGCTCAAGCTAATCTTTCTCTTCCAAGTCCCTTTGAAACCCTTGATCAGCTGAAACAAAAGT
TTTTAGATGTTGGTCTCAACGACAACGTCGATCTGGTTGCGTTATCTG
GTAACTATATTTGAACTATGCTTAGTTATTTTCAATTTAACGGTCAGACGAGATGCAGCCATGGGCAATCAC
AATTTAAACTCTAAACCTTTTCTAGTTTGAGACTATCTGATACCATGTCAAATGATAAATCCATCCGAAAATCTAAGTGTTTATAATAGTTTTGGTACATCTAACAATCTTAAACAATAA
AATAAGATCTTCTAACATTTATAGAAACGGGAGAGATCAATTAGCATAGTTTGCTACTTGGGTTGATGGAAAGGAGTGTGATGAATTATTGTTATAACCTTTTTTTTAATTGGTCTTTTA
AAACTTTATACAAAACTTATTAATTATGGGAAAATTATTGAGTTTAAAGCGTATATTTCTATTTATACACTGATTGACATATTTATTAGTATTAGTTTAAATAATGAAGTTTGTATCGAT
CATATAGAACACTCATATTTACGTATCACTTTTCTTATTAGTAGTTATATATACATTAAGTCTAAGTAAAAATCTCTTTTAATTATATCCGATGTATTTTATATTTGTAGATGTGACATG
GTATACTGTGTGAATTAAAAGTAATATTTAACCTGCTATAGTAAGTTAACAATAATTAAGGAGTTACCACTTGAGAAAGTTACAAGTCAATTTTTCTTGTTTTTGTTACTTATTTAGCAA
GTAATACTTAATAGATTTTAATAGTTAAGATTAAAAGTTGGATATCTAAAGATTATAATTTATATAAGGAGGGACATATATATATATATAAGTGATTATTAATGATTATTTTCTCTTCTT
CGTTTTAAGGTGGTCATACATTTGGAAGAGCTCAATGCTTTACTTTCAGCCAGCGTCTAGTCGATTTCAATGGTACTGGTGCTCCAGACACATCATTGAACACAACTTATGGAGATACAC
TTCGAGCATTGTGCCCTGTAAATGGAACTCCAAGTGTCTTGACCGACCTTGATTCAGCAACACCTGACGCATTTGACAACAGATATTTCTCAAATCTTCTGAGTGGCAAAGGCCTTCTGC
AAAGTGATCAAGAACTGTTCTCAACTCCTGGTGCTGATACTGCTGGCATTGTCACCAACTTTAGCACTAGCCAAACTGCTTTCTTTGAGAGCTTCGTGGTTTCCATGATCAGGATGGGAA
ATCTCAGTGTCTTGACAGGCACTGATGGGGAGGTCAGGCTGAATTGCAGAGTTGTTAATCCACCTCTAGCTGAAGATGATAACCTTCTTGTCAGCTCAATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGGAGGTCCTTCATGGACTAATCAACTAGGAAGAAGAGATGCCAGAACAGCAAGCAGAGCTCAAGCTAATCTTTCTCTTCCAAGTCCCTTTGAAACCCTTGATCAGCTGAAACAAAAGT
TTTTAGATGTTGGTCTCAACGACAACGTCGATCTGGTTGCGTTATCTG
GTGGTCATACATTTGGAAGAGCTCAATGCTTTACTTTCAGCCAGCGTCTAGTCGATTTCAATGGTACTGGTG
CTCCAGACACATCATTGAACACAACTTATGGAGATACACTTCGAGCATTGTGCCCTGTAAATGGAACTCCAAGTGTCTTGACCGACCTTGATTCAGCAACACCTGACGCATTTGACAACA
GATATTTCTCAAATCTTCTGAGTGGCAAAGGCCTTCTGCAAAGTGATCAAGAACTGTTCTCAACTCCTGGTGCTGATACTGCTGGCATTGTCACCAACTTTAGCACTAGCCAAACTGCTT
TCTTTGAGAGCTTCGTGGTTTCCATGATCAGGATGGGAAATCTCAGTGTCTTGACAGGCACTGATGGGGAGGTCAGGCTGAATTGCAGAGTTGTTAATCCACCTCTAGCTGAAGATGATA
ACCTTCTTGTCAGCTCAATG

Retrieve as FASTA