1. Browse the Database
  2. View Redoxidase
Entry information : RcPrx12 (28691.m000035)
Entry ID 9343
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: RcPrx12 (28691.m000035)
Name (synonym) RcPrx12 (28691.m000035)
Class Class III peroxidase     [Orthogroup: Prx018]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx12
start..stop		 S start..stop
PtPrx102 414 8.11e-147 1..271 72..343
PalPrx04 409 3.31e-145 1..271 66..337
MePrx57 409 8.59e-145 1..269 80..348
PkPrx04 405 2.33e-143 1..271 72..343
Gene structure Fichier Exons►


exon

Literature and cross-references RcPrx12 (28691.m000035)
DNA ref. Phytozome 12:   28691 (21123..9902)
Protein sequence: RcPrx12 (28691.m000035)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271
PWM (Da):   %s   29070.4  
PI (pH):   %s   4.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCDGSLLLDNSATIESEKEALGNNNSARGFEVVDTMKSLLEAACPQTVSCADILTIASQESVTLTGGPSWTNLLGRRDSITANRTLANMNIPGPFDTLERLKFRFSNVGLNNDTDLVALSGAHTFGRAQCRTFIGRLYNFNNTGLPDPTLDPTYLETLRQICPQGGDGRVLANLDPTTPDTFDKNYFSNLQVNKGLLQSDQELFSTPGADTITIVNNFGNNQTAFFEAFVVSMIRMGNLS
PLTGTDGEIRLNCRVVNAPPAEADILPVSS

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing which has not been found yet due to the NNNN in DNA).
DNA ►
Send to BLAST
CDS►
Send to BLAST