Entry information : RcPrx26 (29726.m004037)
Entry ID 9354
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx26 (29726.m004037)
Name (synonym) RcPrx26 (29726.m004037)
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx26
start..stop
S start..stop
EgrPrx129 449 4e-160 1..326 1..323
EcamPrx129-2 447 2e-159 1..326 1..323
EglPrx130 445 1e-158 1..326 1..323
EgrPrx130 445 1e-158 1..326 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 863573..863782 210 N° 2 862693..863460 768  
complement(join(862693..863460,863573..863782))


exon

Literature and cross-references RcPrx26 (29726.m004037)
DNA ref. Phytozome 12:   29726 (863782..862693)
Protein sequence: RcPrx26 (29726.m004037)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (304)
PWM (Da):   %s   35647.17 (33178.8) Transmb domain:   %s   o4-23i
PI (pH):   %s   9 (8.85) Peptide Signal:   %s   cut: 23 range:23-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKIVILLIYFLPTFFISSALSAQLKKGFYQKTCPLAETLVRSTVKNALASDAGIPAALIRLHFHDCFVRGCDASILLNSTPGNKAEKESMGNKGVGGFEVIDEAKAKIESYCPNTVSCADIIAFAARDSVLLSGGTYYDVPGGRRDGTTSLISEVTGNLPDSFFNATQLKQNFANKGLSLEEMVTLSGAHSIGDSHCSSFSKRLYSFNATYSQDPSLDPVYASYLKIKCPRHVKPGLPDPVVPFDPLTPTRLDSNYYKNLKNDKGLLFSDQVLWNSELTKKIVNRNIRHPNKWASKFAAAMGHMGSIEVITGSQGEIRKYCWRMN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGATTGTCATTCTTTTGATATATTTTCTACCCACCTTCTTTATCTCTTCAGCTCTCTCGGCTCAGTTGAAGAAAGGGTTTTATCAAAAAACATGCCCCTTAGCTGAGACTCTA
GTAAGAAGCACAGTTAAAAATGCACTGGCTAGTGATGCTGGCATTCCTGCTGCTCTCATCAGGCTTCATTTCCATGACTGTTTTGTGAGG
GTAATTAAAATCTTGGACATTAACTTTTCC
TCCATGTTCGAGTACGTACATAAATAGGTATACCCCTATAAGTATATACTTAATTTTGCATTTTTCTTTTTTGGCTGAACAGGGTTGTGATGCTTCCATTCTTCTAAATTCGACTCCCGG
AAATAAAGCAGAGAAAGAAAGCATGGGAAACAAAGGTGTCGGAGGCTTTGAGGTGATAGATGAAGCAAAGGCCAAGATAGAGTCTTACTGCCCTAATACAGTTTCATGTGCAGACATTAT
TGCTTTTGCAGCTCGTGATAGTGTTCTTCTCTCTGGTGGCACTTACTATGATGTTCCCGGCGGCCGCCGCGATGGAACCACTTCTTTGATCAGTGAAGTGACTGGAAACCTTCCCGATTC
ATTCTTTAATGCAACTCAGTTGAAACAAAACTTTGCAAACAAGGGTTTGTCACTAGAAGAAATGGTCACACTTTCTGGTGCTCATTCTATTGGCGATTCTCATTGCTCTTCGTTCTCCAA
ACGCTTATATTCTTTTAATGCAACTTATTCACAGGACCCTTCCTTGGATCCTGTCTATGCTAGTTACTTGAAAATCAAATGTCCCAGGCATGTAAAACCTGGTCTGCCTGACCCAGTTGT
GCCCTTTGATCCCTTGACGCCAACTAGGCTTGATAGTAACTACTACAAGAACTTGAAGAATGACAAAGGGCTGCTGTTTTCAGATCAAGTACTATGGAATAGTGAATTGACAAAGAAGAT
TGTAAACAGGAATATCAGGCATCCAAATAAATGGGCTTCCAAGTTTGCTGCTGCTATGGGGCATATGGGTTCAATTGAGGTGATTACTGGGTCACAAGGAGAAATAAGGAAGTACTGCTG
GAGGATGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGATTGTCATTCTTTTGATATATTTTCTACCCACCTTCTTTATCTCTTCAGCTCTCTCGGCTCAGTTGAAGAAAGGGTTTTATCAAAAAACATGCCCCTTAGCTGAGACTCTA
GTAAGAAGCACAGTTAAAAATGCACTGGCTAGTGATGCTGGCATTCCTGCTGCTCTCATCAGGCTTCATTTCCATGACTGTTTTGTGAGG
GGTTGTGATGCTTCCATTCTTCTAAATTCG
ACTCCCGGAAATAAAGCAGAGAAAGAAAGCATGGGAAACAAAGGTGTCGGAGGCTTTGAGGTGATAGATGAAGCAAAGGCCAAGATAGAGTCTTACTGCCCTAATACAGTTTCATGTGCA
GACATTATTGCTTTTGCAGCTCGTGATAGTGTTCTTCTCTCTGGTGGCACTTACTATGATGTTCCCGGCGGCCGCCGCGATGGAACCACTTCTTTGATCAGTGAAGTGACTGGAAACCTT
CCCGATTCATTCTTTAATGCAACTCAGTTGAAACAAAACTTTGCAAACAAGGGTTTGTCACTAGAAGAAATGGTCACACTTTCTGGTGCTCATTCTATTGGCGATTCTCATTGCTCTTCG
TTCTCCAAACGCTTATATTCTTTTAATGCAACTTATTCACAGGACCCTTCCTTGGATCCTGTCTATGCTAGTTACTTGAAAATCAAATGTCCCAGGCATGTAAAACCTGGTCTGCCTGAC
CCAGTTGTGCCCTTTGATCCCTTGACGCCAACTAGGCTTGATAGTAACTACTACAAGAACTTGAAGAATGACAAAGGGCTGCTGTTTTCAGATCAAGTACTATGGAATAGTGAATTGACA
AAGAAGATTGTAAACAGGAATATCAGGCATCCAAATAAATGGGCTTCCAAGTTTGCTGCTGCTATGGGGCATATGGGTTCAATTGAGGTGATTACTGGGTCACAAGGAGAAATAAGGAAG
TACTGCTGGAGGATGAAT

Retrieve as FASTA