Entry information : RcPrx29 (29764.m000744)
Entry ID 9357
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx29 (29764.m000744)
Name (synonym) RcPrx29 (29764.m000744)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx29
start..stop
S start..stop
PnPrx90 324 7e-113 6..201 1..195
MePrx120 321 8e-112 8..201 4..196
PtPrx90 320 1e-111 6..201 1..196
VvPrx42 310 2e-107 6..201 1..195
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 118187..118423 237 N° 2 117270..117461 192 N° 3 116375..116551 177  
complement(join(116375..116551,117270..117461,118187..118423))


exon

Literature and cross-references RcPrx29 (29764.m000744)
DNA ref. Phytozome 12:   29764 (118423..116375)
Protein sequence: RcPrx29 (29764.m000744)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   202
PWM (Da):   %s   21635.79  
PI (pH):   %s   6.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSIVMSPKKLAAQLCMTSIVIVSFCQIGVHSQLQVGFYANSCSLAEFIVKDAVRNGFNKDRGVAAALVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDNAKSRLEALCKGIVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLSSETFTNLPPPTFSVNQLTQLFANKGFSQEEMVTLSGEYN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing which has not been found yet).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATCCATAGTTATGAGTCCAAAGAAGCTAGCAGCTCAACTATGTATGACTTCAATAGTTATTGTTTCATTTTGTCAAATTGGCGTTCATTCTCAGCTTCAAGTTGGGTTTTATGCA
AACTCATGTAGTTTGGCTGAGTTTATTGTTAAAGATGCTGTTAGGAATGGTTTCAATAAGGACAGAGGAGTGGCTGCTGCTCTTGTAAGAATGCACTTTCATGATTGCTTTGTTAGG
GTA
AGTATTGATATTTCTTAGTTGACTGAATACATTGTTTCCTCTTCAATTTTACTAATCTAACTTATGATACTGTTGGTGTTTTCAATTGATAAAGAAAACTTATAACATTATTTAATTTTA
TTTAATTTCGGATATCTCTCAAATCTTTAGATTCTTAACTTTCGGCCTTTTATTCTTTTTACCCCAATAAATATTTTTTTTATTCTTAATTTAAATGAGTAAAATATAAGTATAGAGGTG
AAGGAAAATAAAATAAAAATTGGAAAATGTCATAGATCATAAAAAAAAAAATTGTTCAGATGTGTTAAGTGTTAAATTAGTAAAATCTAGGAGTGAAACTATGCATTAGTTAATCCTTTC
TTATTTCTAATTCACGTAGTTATTAATTAATATTAATTGGATATCTTATGCGCATGATACAATTAATTATCTAATTTATTGGATTAATTTGAAACTATTTCTCTCTTTTCTGAATTCTTT
TTCTTTCCAATTCTTATATATAATTAAAGTTGTATTGCTTCTGATTCAATATACATTACATTTGTTATAGATAACCCATCGTTTATAATTTTTTACTTAAAAAGAACAATTACATGATGC
AACTAAACTTTTCTTAGTATTAGAAGGCTTTTAATTTATTTTATTTTATTTTTTTCCTTTTAATCTTGTATTTTGTTTTTCTATATGAACTTGGGCATGCTTAACGTACGTAATGCATAT
AGGGATGTGATGGGTCCGTGCTTATCGATTCCACTCCCTCAAACACAGCAGAGAAAGACTCTCCAGCGAATAACCCTAGTCTGAGAGGCTTTGAAGTGATAGACAATGCAAAGTCTAGAC
TAGAGGCCCTTTGTAAAGGAATTGTTTCTTGTGCTGATATAGTTGCATTTGCAGCAAGAGACAGTGTTGAGATA
GTAAGTAGATGTGTATATATGTACCACCTTCAACTAATTATTTGTT
TTACACTTGTTGGAGCATGTAGTTATGGTACATTCAGAATATGAAGAAATATTAGTGAATATAACACATAACTGAAAACCCATTAATTTGACTTAATTAGATTCAAATTATTTTTAATTG
TGCCTTAGAACTCATTTACTCTCATGCTATACTTGGTTGAAATCCATAAAAAAGATTCATTTCATTTAAGAAAAAAAGATGAGAAATAAAATAAAATTAAAATGATAAAGTTGAATGAAA
TATTTTGGTGTTATAGAATGTATTGACTTACTATATGAAATTCATTTAAAAATTATATCTATTTTGTTAGAATTTAGTTTAACTATAACCAATTCCATACAAATTTGATTATGCAGAATA
CTAAATTAGCTTTTTAAAACATATAATTTTAAATTCACAAATGAATTTCATAAACTTTATGGATTGTAACAAAAAATTATGTCAAGTTATACTAGAAAGAGGATCTTGGAGCATGCCTTG
TCTCATATTAAGCATATAAAGAAATATAAAAAAAAAAAATCATATAACGTAAAGTCATATTTTATAGTAAAGCCGTAATTACACTTAATTGTTACCCTATTCACACTCTTTTCTTACTTA
ACTCTAATTTTACTATATTCTAAATTACATTATACTTGAGGCCATTAGGTTATTTCATATCATTTTGTGTAGACTGGAGGGCTTGGCTATGATGTTCCGGCAGGAAGAAGAGATGGCAGA
ATTTCTTTATCCTCAGAGACATTCACAAACTTACCTCCTCCAACATTTAGTGTTAATCAGCTCACTCAGTTATTTGCAAACAAGGGTTTCTCGCAAGAAGAAATGGTTACATTGTCTGGT
GAATACAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATCCATAGTTATGAGTCCAAAGAAGCTAGCAGCTCAACTATGTATGACTTCAATAGTTATTGTTTCATTTTGTCAAATTGGCGTTCATTCTCAGCTTCAAGTTGGGTTTTATGCA
AACTCATGTAGTTTGGCTGAGTTTATTGTTAAAGATGCTGTTAGGAATGGTTTCAATAAGGACAGAGGAGTGGCTGCTGCTCTTGTAAGAATGCACTTTCATGATTGCTTTGTTAGG
GGA
TGTGATGGGTCCGTGCTTATCGATTCCACTCCCTCAAACACAGCAGAGAAAGACTCTCCAGCGAATAACCCTAGTCTGAGAGGCTTTGAAGTGATAGACAATGCAAAGTCTAGACTAGAG
GCCCTTTGTAAAGGAATTGTTTCTTGTGCTGATATAGTTGCATTTGCAGCAAGAGACAGTGTTGAGATA
ACTGGAGGGCTTGGCTATGATGTTCCGGCAGGAAGAAGAGATGGCAGAATT
TCTTTATCCTCAGAGACATTCACAAACTTACCTCCTCCAACATTTAGTGTTAATCAGCTCACTCAGTTATTTGCAAACAAGGGTTTCTCGCAAGAAGAAATGGTTACATTGTCTGGTGAA
TACAAT

Retrieve as FASTA