Entry information : RcPrx39 (29799.m000632)
Entry ID 9366
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: RcPrx39 (29799.m000632)
Name (synonym) RcPrx39 (29799.m000632)
Class Class III peroxidase     [Orthogroup: Prx103]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx39
start..stop
S start..stop
PtPrx31 261 2e-88 20..181 140..310
NnPrx46 251 4e-84 20..181 148..318
CclPrx34 230 2e-76 20..180 138..308
CsPrx42 229 6e-76 20..180 138..308
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 188999..189178 180 N° 2 189201..189584 384  
join(188999..189178,189201..189584)


exon

Literature and cross-references RcPrx39 (29799.m000632)
DNA ref. Phytozome 12:   29799 (188999..189584)
Protein sequence: RcPrx39 (29799.m000632)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188
PWM (Da):   %s   21338.77  
PI (pH):   %s   9.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
NLNSIFLNKICQYFFFSLQVGGPRWEVQKGRRDGLISKASRVNGNFPQVNQTIPQLFSLFVALSGAHTIGFSHCKEFMPRIYGYNKTFDIDPTMDQQYAVSLRGSCRRKTHPDSTVVALNDVTTPFTFDNVYFRNLQKGLGLLSKDQMLAYHPLTRSNVNMMAEDQQIFFNYFAAAMIKLGLDRSQVS

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing which has not been found yet). 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATTTAAATTCAATATTTTTAAATAAAATATGTCAATATTTTTTTTTTTCTTTGCAGGTAGGAGGACCGAGATGGGAAGTGCAGAAGGGAAGAAGAGATGGGCTTATTTCTAAGGCATCA
AGAGTGAATGGCAACTTTCCTCAAGTGAACCAAACAATCCCTCAGCTATTTTCTCTTTTC
AGATCCAAAGGTTTACCTCTCTGTAGCTTTGTCAGGTGCACATACCATAGGTTTTTCTCA
TTGTAAGGAATTCATGCCACGAATTTATGGGTACAACAAGACATTTGACATAGATCCAACCATGGACCAGCAATATGCAGTTAGCCTTCGAGGGTCTTGCCGCCGTAAGACACATCCAGA
CTCAACTGTGGTTGCACTGAATGATGTTACCACACCATTTACTTTTGACAATGTTTATTTCCGTAATCTTCAAAAGGGGCTTGGATTGCTATCCAAAGATCAGATGTTGGCTTACCACCC
ATTGACTCGGAGTAATGTCAATATGATGGCTGAAGATCAACAAATCTTTTTCAATTACTTTGCTGCGGCTATGATAAAATTAGGCTTAGATCGGAGTCAAGTCAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATTTAAATTCAATATTTTTAAATAAAATATGTCAATATTTTTTTTTTTCTTTGCAGGTAGGAGGACCGAGATGGGAAGTGCAGAAGGGAAGAAGAGATGGGCTTATTTCTAAGGCATCA
AGAGTGAATGGCAACTTTCCTCAAGTGAACCAAACAATCCCTCAGCTATTTTCTCTTTTC
GTAGCTTTGTCAGGTGCACATACCATAGGTTTTTCTCATTGTAAGGAATTCATGCCACGA
ATTTATGGGTACAACAAGACATTTGACATAGATCCAACCATGGACCAGCAATATGCAGTTAGCCTTCGAGGGTCTTGCCGCCGTAAGACACATCCAGACTCAACTGTGGTTGCACTGAAT
GATGTTACCACACCATTTACTTTTGACAATGTTTATTTCCGTAATCTTCAAAAGGGGCTTGGATTGCTATCCAAAGATCAGATGTTGGCTTACCACCCATTGACTCGGAGTAATGTCAAT
ATGATGGCTGAAGATCAACAAATCTTTTTCAATTACTTTGCTGCGGCTATGATAAAATTAGGCTTAGATCGGAGTCAAGTCAGC

Retrieve as FASTA