Entry information : RcPrx43 (29842.m003654)
Entry ID 9369
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx43 (29842.m003654)
Name (synonym) RcPrx43 (29842.m003654)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx43
start..stop
S start..stop
MePrx108 572 0 1..330 1..329
MePrx110 565 0 1..330 1..329
MePrx97 557 0 1..330 1..328
PtPrx91 502 0 1..330 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 751484..751702 219 N° 2 751893..752084 192 N° 3 752188..752353 166 N° 4 752458..752870 413
join(751484..751702,751893..752084,752188..752353,752458..752870)


exon

Literature and cross-references RcPrx43 (29842.m003654)
DNA ref. Phytozome 12:   29842 (751484..752870)
Protein sequence: RcPrx43 (29842.m003654)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (304)
PWM (Da):   %s   35902.57 (33143.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.24 (9.07) Peptide Signal:   %s   cut: 27 range:27-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASKSFSALLIQLILVLFVFNPANAQLKVGFYSKTCPRAEAIVKEVINQVMSVAPSLAGPLLRMHFHDCFVRGCDGSVLLNATSSTQQVEKDALPNLSLRGYQIIDRVKTALEKECPGVVSCADVVAIVARDVTVASKGPYWEVETGRRDGRVSIGAETLTNLVAPNANITTLITRFQAKGLNLKDLVVLSGGHTIGTSHCSSFNNRLYNFTGMGINNDFDPTLDSEYVRKLKIKCRPGDQNSLVEMDPGSFKTFDESYFTLVSKRRGLFQSDAALLDNRVTKNYIKLQAATKSSTFFKDFGVSMVKMGRVDVLTGSAGEIRKVCSMV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCCAAGTCATTTTCAGCTCTTTTAATCCAATTAATCCTTGTATTATTTGTCTTTAACCCTGCCAATGCGCAACTGAAAGTAGGGTTTTACTCCAAGACATGCCCGCGAGCT
GAAGCCATTGTTAAGGAGGTTATCAATCAAGTCATGTCGGTAGCTCCATCCCTTGCTGGCCCCTTGTTGAGGATGCATTTTCATGATTGCTTTGTTAGG
GTAAGGAAAAAAAGTTACTAT
CTTATGTAAATTATTTTAATTTTACTCATAATCTCACAGTCCTGACATGAGTACTTCAACATCATTAAGCGAATCTTTTTCGCACAAAAAGTATCATAAAGCTAATTGTTCATTGGTTTT
CTACACACAAGAGAAAAAAAAAGTTTATGGATAATTATGATGAGTGCAGGGTTGTGATGGGTCAGTGCTATTAAACGCAACTAGTAGCACTCAGCAAGTTGAAAAAGATGCACTTCCGAA
TCTAAGTCTTCGAGGATACCAGATTATCGACAGAGTGAAGACTGCATTAGAAAAAGAATGTCCTGGAGTTGTTTCATGTGCTGACGTTGTGGCTATTGTTGCTAGGGATGTCACTGTGGC
G
GTAAAACCATGCATTTCCTGTCATCAATATTTCCATTTTTGCATGCATTATTTTCAAAATGATGAATGATTTTATTTATCTAAAAATTAATTTATCGTCTCAGAGCAAGGGACCATACT
GGGAAGTCGAAACAGGAAGAAGAGATGGAAGGGTGTCCATCGGAGCAGAAACCTTAACAAACCTTGTAGCTCCAAATGCAAACATTACTACTTTGATTACAAGATTTCAAGCTAAGGGTT
TGAATTTAAAAGACCTAGTAGTGCTATCAG
GTACGTAAAACACCATGATGTAAGACGTACGCGAAAATATAGAAATCTGAATAGCTTTTATTCATTGGTGCTGGAATACGATATTGATCT
TTTATGGTATGCAGGTGGGCACACAATTGGCACTTCTCACTGCTCTTCATTCAATAATCGACTTTACAACTTCACTGGAATGGGAATCAATAATGATTTTGATCCCACATTGGATTCAGA
ATATGTAAGAAAATTGAAAATCAAATGCAGGCCAGGAGATCAAAATTCGCTTGTAGAAATGGATCCTGGCAGTTTCAAGACATTTGATGAAAGTTATTTCACACTTGTGAGTAAAAGAAG
GGGCCTTTTCCAATCTGATGCAGCTCTTCTTGACAATAGGGTGACAAAAAATTACATTAAGCTTCAGGCTGCCACAAAAAGTTCTACTTTCTTTAAAGACTTCGGTGTATCCATGGTGAA
AATGGGTCGTGTTGATGTTCTCACGGGTTCTGCAGGTGAAATCAGGAAGGTTTGCAGCATGGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCCAAGTCATTTTCAGCTCTTTTAATCCAATTAATCCTTGTATTATTTGTCTTTAACCCTGCCAATGCGCAACTGAAAGTAGGGTTTTACTCCAAGACATGCCCGCGAGCT
GAAGCCATTGTTAAGGAGGTTATCAATCAAGTCATGTCGGTAGCTCCATCCCTTGCTGGCCCCTTGTTGAGGATGCATTTTCATGATTGCTTTGTTAGG
GGTTGTGATGGGTCAGTGCTA
TTAAACGCAACTAGTAGCACTCAGCAAGTTGAAAAAGATGCACTTCCGAATCTAAGTCTTCGAGGATACCAGATTATCGACAGAGTGAAGACTGCATTAGAAAAAGAATGTCCTGGAGTT
GTTTCATGTGCTGACGTTGTGGCTATTGTTGCTAGGGATGTCACTGTGGCG
AGCAAGGGACCATACTGGGAAGTCGAAACAGGAAGAAGAGATGGAAGGGTGTCCATCGGAGCAGAAACC
TTAACAAACCTTGTAGCTCCAAATGCAAACATTACTACTTTGATTACAAGATTTCAAGCTAAGGGTTTGAATTTAAAAGACCTAGTAGTGCTATCAG
GTGGGCACACAATTGGCACTTCT
CACTGCTCTTCATTCAATAATCGACTTTACAACTTCACTGGAATGGGAATCAATAATGATTTTGATCCCACATTGGATTCAGAATATGTAAGAAAATTGAAAATCAAATGCAGGCCAGGA
GATCAAAATTCGCTTGTAGAAATGGATCCTGGCAGTTTCAAGACATTTGATGAAAGTTATTTCACACTTGTGAGTAAAAGAAGGGGCCTTTTCCAATCTGATGCAGCTCTTCTTGACAAT
AGGGTGACAAAAAATTACATTAAGCTTCAGGCTGCCACAAAAAGTTCTACTTTCTTTAAAGACTTCGGTGTATCCATGGTGAAAATGGGTCGTGTTGATGTTCTCACGGGTTCTGCAGGT
GAAATCAGGAAGGTTTGCAGCATGGTTAAC

Retrieve as FASTA