Entry information : RcPrx56 (30015.m000222)
Entry ID 9379
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx56 (30015.m000222)
Name (synonym) RcPrx56 (30015.m000222)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx56
start..stop
S start..stop
MePrx81 511 0 33..320 34..320
PtPrx74 502 0 1..320 1..320
VvPrx13 490 1.55e-176 1..320 1..318
RcPrx57 486 6.45e-175 5..320 4..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9379' 'join(136329..136544,136640..136834,137211..137768)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 136329..136544 214 N° 2 136640..136834 193 N° 3 137211..137768 556  
join(136329..136544,136640..136834,137211..137768)


exon

Literature and cross-references RcPrx56 (30015.m000222)
DNA ref. Phytozome 12:   30015 (136329..137768)
Protein sequence: RcPrx56 (30015.m000222)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   35053.93 (32656.7) Transmb domain:   %s   i12-31o
PI (pH):   %s   8.55 (8.20) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSRSKCCFRAFLVLVVASLASASPLLSPYYYDKVCPEALPTIKR
IIEAAVYEEPRMGASLLRLHFHDCFVN
GCDASVLLDSSPTIDSEKNAVANLNSARGFEVIDQIKLAVDEVCGHPVVSCADILTVAARDSVVALGGPTWTVQLGRRDSTTASRTQANRDIPSPFMDLPALINNFKNQGLNEKDLVALS
GGHTLGFAKCFVFKDRIYNDTKTIDPKFAKARRSTCPRTGGDTNLAPLDPTPANFDIAYFTNLINKRGLLHSDQQLFVGGSTDALVTKYSLNAKAFSADFVKSMVKMGNIKPLTGKQGEI
RLNCRKVNDYY

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCACGCAGCAAGTGTTGTTTCCGGGCTTTTCTCGTACTGGTTGTTGCTTCTCTAGCTTCTGCATCTCCACTACTCTCTCCTTATTACTATGACAAAGTGTGTCCGGAAGCTTTA
CCAACGATTAAACGCATAATTGAGGCTGCAGTGTACGAAGAACCACGCATGGGTGCCTCTTTGTTGCGTCTGCATTTCCATGACTGCTTTGTCAAT
ATGTACTTGACTGGTTAACTGCCA
CAATTTTCTCCTCATTTTACTTTGATCCTTTAGTAATCATTTATTAATATGTTTTTTGTGGGTAATTACACAGGGTTGTGATGCATCAGTTCTTTTGGATTCTTCGCCCACTATTGATAG
TGAAAAGAATGCCGTGGCCAACTTAAATTCTGCCAGAGGATTCGAGGTTATCGACCAAATTAAGCTGGCAGTAGATGAAGTATGTGGCCATCCTGTGGTATCCTGCGCAGACATTTTAAC
GGTCGCAGCTCGCGATTCTGTAGTTGCG
CGGTATTTGCCATAATCACTTCCATTTGTTTTTTTTTGTTAAATTAAAGGGTCCAACTGAAAATTTAAAACATAATCTCACAAACATGCATG
AAGATAACTATCGTACCATTGAGAAGTAATTATAATACATCGAGCTAAAACTCGTTAACTGAAATTAATATGTATATAATAATGATAAAAAAAAAAAAAGAATCCAGTTCGAGGCCATTT
CTTTTTTAATGTATATTTATAGAGTTAATCTACAATGTTTCTTTGTAAACTAAAAAGTCATGATTATAACTCTATATCTCTTTGCATGCTTAAGTTAATAGTTGATAGAAAATATAGCAG
AGAGAAAAGAAGGCATAAATTAATGCATATATAAAAAAATTTGCAGCTCGGGGGGCCAACATGGACGGTGCAGCTAGGAAGAAGAGACTCAACAACAGCAAGCAGGACCCAGGCAAACAG
AGATATTCCCTCACCATTTATGGACCTTCCTGCACTTATTAATAACTTCAAGAACCAAGGTCTAAACGAGAAAGATCTTGTTGCTCTCTCTGGTGGCCATACATTAGGGTTCGCAAAGTG
TTTTGTCTTTAAGGACCGCATCTACAATGACACGAAGACTATCGACCCTAAATTTGCAAAAGCCCGTAGATCAACTTGTCCAAGAACTGGCGGTGATACAAATCTTGCGCCTCTAGACCC
AACACCAGCAAATTTTGACATCGCATACTTCACCAACTTAATCAATAAAAGAGGTCTTCTGCATTCCGATCAACAACTATTCGTCGGTGGCTCAACGGATGCATTGGTCACGAAATATAG
CTTAAATGCCAAAGCTTTCTCTGCAGATTTCGTTAAGTCTATGGTTAAGATGGGAAATATAAAGCCATTAACAGGAAAGCAAGGCGAGATTCGTTTGAATTGCAGGAAGGTGAATGACTA
CTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCACGCAGCAAGTGTTGTTTCCGGGCTTTTCTCGTACTGGTTGTTGCTTCTCTAGCTTCTGCATCTCCACTACTCTCTCCTTATTACTATGACAAAGTGTGTCCGGAAGCTTTA
CCAACGATTAAACGCATAATTGAGGCTGCAGTGTACGAAGAACCACGCATGGGTGCCTCTTTGTTGCGTCTGCATTTCCATGACTGCTTTGTCAAT
GGTTGTGATGCATCAGTTCTTTTG
GATTCTTCGCCCACTATTGATAGTGAAAAGAATGCCGTGGCCAACTTAAATTCTGCCAGAGGATTCGAGGTTATCGACCAAATTAAGCTGGCAGTAGATGAAGTATGTGGCCATCCTGTG
GTATCCTGCGCAGACATTTTAACGGTCGCAGCTCGCGATTCTGTAGTTGCG
CTCGGGGGGCCAACATGGACGGTGCAGCTAGGAAGAAGAGACTCAACAACAGCAAGCAGGACCCAGGCA
AACAGAGATATTCCCTCACCATTTATGGACCTTCCTGCACTTATTAATAACTTCAAGAACCAAGGTCTAAACGAGAAAGATCTTGTTGCTCTCTCTGGTGGCCATACATTAGGGTTCGCA
AAGTGTTTTGTCTTTAAGGACCGCATCTACAATGACACGAAGACTATCGACCCTAAATTTGCAAAAGCCCGTAGATCAACTTGTCCAAGAACTGGCGGTGATACAAATCTTGCGCCTCTA
GACCCAACACCAGCAAATTTTGACATCGCATACTTCACCAACTTAATCAATAAAAGAGGTCTTCTGCATTCCGATCAACAACTATTCGTCGGTGGCTCAACGGATGCATTGGTCACGAAA
TATAGCTTAAATGCCAAAGCTTTCTCTGCAGATTTCGTTAAGTCTATGGTTAAGATGGGAAATATAAAGCCATTAACAGGAAAGCAAGGCGAGATTCGTTTGAATTGCAGGAAGGTGAAT
GACTACTAT

Retrieve as FASTA