1. Browse the Database
  2. View Redoxidase
Entry information : RcPrx64 (30138.m003856)
Entry ID 9386
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: RcPrx64 (30138.m003856)
Name (synonym) RcPrx64 (30138.m003856)
Class Class III peroxidase     [Orthogroup: Prx021]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx64
start..stop		 S start..stop
MePrx12 388 1.21e-137 1..225 3..224
MePrx128 386 1.13e-136 1..225 3..226
PtPrx92 373 1.17e-131 1..225 1..224
PtPrx95 366 8.53e-129 17..225 18..224
Gene structure Fichier Exons►


exon

Literature and cross-references RcPrx64 (30138.m003856)
DNA ref. Phytozome 12:   30138 (241393..240267)
Protein sequence: RcPrx64 (30138.m003856)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   24226.35  
PI (pH):   %s   5.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSLHSKFLTCQLVALVSIFIFSTTLYAIDPPLTLDYYASTCPSVFDIIRKEMECEVLSDPRNAALVVRLHFHDCFVQGCDGSVLLDDTITLQGEKKASPNVNSLVGFRIIDKVKNKVE
SECPGIVSCADILTVAARDAVILVGGPYWDVPVGRKDSKTASLELASANIPTPDEGLLSIISKFLYQGLSVTDMVALSGTGAHTIGMARCANFRSRIYGDFETTS

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to 'NNNNN' in DNA). 1 EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST