Entry information : RcPrx65 (30146.m003601)
Entry ID 9387
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2014-01-09 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-09 (Qiang Li)
Peroxidase information: RcPrx65 (30146.m003601)
Name (synonym) RcPrx65 (30146.m003601)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx65
start..stop
S start..stop
MePrx84 486 3.82e-172 19..401 50..420
CclPrx09 431 6.04e-150 26..400 59..462
PtPrx19 410 5.95e-144 39..401 13..316
LePrx106 411 1.34e-142 42..401 82..414
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9387' 'complement(join(1238382..1238974,1239238..1239403,1239472..1239660,1240424..1240684))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1240424..1240684 259 N° 2 1239472..1239660 187 N° 3 1239238..1239403 164 N° 4 1238382..1238974 591
complement(join(1238382..1238974,1239238..1239403,1239472..1239660,1240424..1240 684))


exon

Literature and cross-references RcPrx65 (30146.m003601)
DNA ref. Phytozome 12:   30146 (1240684..1238382)
Protein sequence: RcPrx65 (30146.m003601)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   402 (338)
PWM (Da):   %s   44120.63 (35814.9)  
PI (pH):   %s   4.61 (7.62) Peptide Signal:   %s   cut: 25 range:25-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIHNEEIKESFEEYYYTSSSWDLLPSFFLSNEQEAHPQTRSLEYDFYRNSCPQAEKIIQNVVRELYKVKFSVSPALLRLVFHDCFIAGCDASILLDAVDGKQSEKDSNPNENLKGYDIID
KIKSQIEEVCPGIVSCADIVVLAAREGVLQAGGPFYPLFTGRRDSTEPFSNLATNELPSPNADLSETLASFSSRGFDERETVSILAHSIGMIHCKFFLNRLYDFGGTYGPDPSLDPQFLN
FLRSKCNTSGASEVPAASPPFDILVSSSTETSPPHSVMSSAAPPSLSFRGSLSSPPLCTAPSVSFENSLLSSPEDLGINMAYEGPGVDFGTLYYRSLLHGRGILYSDQQLMSGEETGIWV
RAYASDVSLFRRDFAQAMMKLSNLNVLTGSAGQVRRNCSKVV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Extra sequence at 5' end has been removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCATAACGAAGAGATCAAGGAAAGCTTCGAAGAATATTATTACACTTCTTCTTCTTGGGATTTGCTTCCTTCTTTTTTCTTGTCTAACGAACAAGAAGCACATCCTCAAACTAGG
TCACTTGAATATGACTTCTATCGCAATTCTTGTCCACAAGCTGAGAAAATCATTCAAAATGTTGTTCGAGAATTATACAAAGTCAAGTTCAGTGTTTCTCCTGCTCTCTTGAGGCTTGTT
TTCCATGATTGTTTCATTGCG
GTAATGATCTTTCTTTCTTGTTCTTGTTTATTTGTAATGGATTTATTGTTTCTTGGTTTTATTTTATCTGTTTTTTGGTAAAGTTGTGGTCTTTAGTTT
GTTAACTTTGTGTATTAGTATCTCAGTTCTTTATAAAATTGATGTGGGTTTTGTTGTTATTGGTGGTTATTATGAGATTTTTAGCCTTTTGTTATTGATCTTGAGGTGGGTTTTTGATTT
GGTGATGTAGTGCAATCTTACTTGTTATTTATGGGGTTTTCTTTTGGTTCTTGAAGTTTTTTACTTAACTATGAGAATAATGTCTTAGTCTTCGTGAAACTGATGTGGGTTTTGTTATTG
ACATTTCTTGTAAAACATGTAGGATCTTGTTGATCATGAAGTGGATTTTCAGTTTCTAGGGTTTTGCCGGTGTTTCCTTTTGATAATTTTCTTTATTAGTTCTGTTGGTATCGATGTGAT
AAAAGAAAGTTTCTGTTACTAACGTAGTCTAGACTATTTTTTGACAGTTCTGTGAACATTGATTGAACTTTCTCTGATGTAAAAGTTGAGGTTTCCATTCCAATAAGAGTTTGGTTCAGT
TCCAGTTTTGTAGTGCTTCTGGCGTCAAAATCTATCTGCTTCTGATAGAGTTCTTCTGGATTTGTACCTAATTTTGATAATTTCTCGATTCTCATGTATTGTTATGTATTTTTTTGGTTT
GTTGCGCCTGTGCTGCTTTCACTTGCAATTTTGATTTAGTTGCTGTGCAATGAGTTTTCTGCAGGGGGTTGTGATGCTTCTATTCTATTGGATGCTGTTGATGGCAAACAATCTGAGAAA
GATTCTAACCCAAATGAAAACTTGAAGGGTTATGATATAATTGACAAAATCAAGTCACAGATTGAAGAAGTTTGCCCTGGAATCGTTTCTTGTGCAGATATTGTTGTCTTGGCAGCCAGA
GAAGGTGTTTTACAG
GTATATAAACCTTCATTTCCACCTCTTTCTCTCTCTCCCTCAGGATTTAATTGCATTTTGAATTTCAGGCGCTGGTGGTCCATTCTATCCACTCTTCACTGGCAG
AAGAGATAGTACTGAACCCTTCTCAAACTTGGCAACAAATGAGCTTCCTTCACCGAATGCTGATCTTTCAGAAACCCTTGCATCTTTTTCTTCTAGGGGTTTTGATGAAAGAGAAACTGT
TAGTATCTTAG
GTATTATTCTTGCTCTTATTCATGTTTTTTTCTTTTCTTATTTTGGTGAAAAATCTTGGTTATGCTTTATTGATTCCGTCTTCACTGTTTGCGTTGTCCGAGTTCTTAT
GCAACATCCTTTAACTTGTTTTTAAACCTTCGTTTTTGTTTATGTCTATTAATTTGTGTGTTTGATTAGCCACAAATTAGATTTCAGCTTCTGATCGTTCTCTTGTTATGCACCTGAACA
TTTCAAGCTGTTTCCTTCCTTTATTTTTGATCAGGTGTGCTCACAGCATTGGAATGATCCATTGCAAATTTTTCCTGAACCGTCTATACGACTTTGGCGGGACTTATGGGCCTGATCCCT
CTCTGGATCCCCAATTCCTCAACTTTCTAAGGTCAAAATGCAACACCAGTGGTGCATCAGAGGTACCAGCAGCTTCACCTCCCTTTGATATCTTAGTGTCATCATCAACGGAAACCTCAC
CACCCCATAGCGTGATGTCATCAGCAGCACCACCATCACTTTCCTTCCGAGGTTCATTGTCTTCCCCACCATTATGCACTGCTCCATCAGTTTCCTTTGAGAATTCACTCCTGTCCTCAC
CTGAAGATCTAGGAATCAATATGGCCTATGAGGGACCTGGAGTAGATTTTGGCACATTGTACTACCGCAGTCTTCTGCACGGTAGAGGAATCCTCTATTCTGATCAGCAACTAATGTCTG
GGGAAGAAACTGGGATTTGGGTCAGAGCATATGCTTCGGATGTGTCCTTATTTCGCCGGGACTTTGCCCAGGCAATGATGAAGCTCTCAAATCTCAATGTCTTGACAGGTTCAGCAGGTC
AGGTCAGACGCAATTGTTCTAAGGTGGTA

Retrieve as FASTA