Entry information : RcPrx80 (30190.m011146)
Entry ID 9402
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx80 (30190.m011146)
Name (synonym) RcPrx80 (30190.m011146)
Class Class III peroxidase    [Orthogroup: Prx065]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx80
start..stop
S start..stop
RcPrx84 616 0 1..321 1..322
MePrx126 501 0 1..321 1..321
RcPrx85 494 3e-178 1..321 1..320
RcPrx77 482 2e-173 1..321 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2175503..2175721 219 N° 2 2175833..2176024 192 N° 3 2176174..2176339 166 N° 4 2176430..2176815 386
join(2175503..2175721,2175833..2176024,2176174..2176339,2176430..2176815)


exon

Literature and cross-references RcPrx80 (30190.m011146)
DNA ref. Phytozome 12:   30190 (2175503..2176815)
Protein sequence: RcPrx80 (30190.m011146)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (295)
PWM (Da):   %s   34034.47 (31145.1)  
PI (pH):   %s   4.53 (4.45) Peptide Signal:   %s   cut: 27 range:27-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASHLSFACMILTIFFIPNYSSLCQAQLSSNFYDNTCPNALTTIKSAIDAAIESEQRMAASLIRLHFHDCFVQGCDGSVLLVDTPTFTGEKSARNNANSIRGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVNLGRRDSTTASLAQANSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFRDRIYNNASDIDPDFAATRRGNCPQTGGNGNLAPLDLVTPNNFDNNYYSNLMAKRGLLASDQILFSGGSTDSIVNEYSTDSSSFDSDFAAAMVKMGNISPLTGTQGEIRRLCSAV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCCATTTATCTTTTGCTTGCATGATTTTAACGATTTTCTTCATACCTAATTACTCAAGCTTATGTCAAGCACAACTTTCTTCAAACTTCTATGACAATACATGTCCTAATGCG
CTTACTACTATTAAATCTGCTATTGATGCAGCAATCGAAAGTGAGCAGAGAATGGCTGCTTCGCTCATTCGTCTTCATTTCCATGATTGCTTTGTGCAG
GTAACCTGAGGCCGCTAAGTT
AATTATGATTAACTCTTAACATATGCATGCATGTTCTGGCTAGAGATTAGTACATATATATATATTAACTATATTTTATTTGTATTGCAGGGTTGTGATGGCTCAGTTTTGCTGGTGGAT
ACTCCCACATTTACTGGGGAGAAATCTGCACGTAACAATGCCAATTCTATCAGAGGAGAAAATGTGATTGATGATGCCAAGGCTCAAGTAGAGAGCATATGTCCTGGAATTGTTTCGTGT
GCTGACATTCTTGCAGTTGCAGCTCGTGATGCATCTGTTGCT
GTAAGTTTGTGCTTAATGATCTCCCTTTATAAAGAAGCGGTTGCCTCGTTTCGTGATAGCCCTATTCTTTCATGAATA
ATCTTTACCAAAAAAATAAATGCTATAGCTAGCCTGAGCATTACTAAACATGGTCTCTGCGTATAAAACAGGCTGGTGGACCATCTTGGACAGTTAATCTTGGAAGAAGGGACTCCACTA
CTGCAAGCTTAGCCCAAGCTAACAGCGATCTTCCTGGCTTTTCAGACCCCCTAAACAGGCTCATTTCTTTGTTCAGCGACAAAGGATTGAATGAAAGAGATATGGTTGCCCTTTCAG
GTT
CGCGTACCTCCTTAATTAATTGCCAATTTCAGTTATGAACTTCTATTATGTTATGACTAAAGAAACTTCATTGCCATATAAATACAGGAGCTCATACTATCGGCCAAGCTCAATGTGTAA
CATTCCGCGACAGGATATACAACAACGCAAGTGATATCGATCCTGACTTTGCTGCCACAAGAAGAGGCAATTGTCCACAAACTGGTGGCAATGGTAATCTTGCACCACTTGATTTGGTCA
CACCCAATAATTTTGATAACAACTACTACAGCAACCTTATGGCAAAAAGAGGGCTTCTTGCGTCAGATCAAATACTTTTCAGTGGCGGATCTACAGACAGCATCGTTAACGAGTACAGCA
CAGACTCTTCATCTTTCGACTCTGATTTTGCTGCTGCTATGGTAAAGATGGGGAATATAAGTCCCTTAACTGGCACTCAAGGGGAGATTCGAAGGCTTTGCAGTGCTGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCCATTTATCTTTTGCTTGCATGATTTTAACGATTTTCTTCATACCTAATTACTCAAGCTTATGTCAAGCACAACTTTCTTCAAACTTCTATGACAATACATGTCCTAATGCG
CTTACTACTATTAAATCTGCTATTGATGCAGCAATCGAAAGTGAGCAGAGAATGGCTGCTTCGCTCATTCGTCTTCATTTCCATGATTGCTTTGTGCAG
GGTTGTGATGGCTCAGTTTTG
CTGGTGGATACTCCCACATTTACTGGGGAGAAATCTGCACGTAACAATGCCAATTCTATCAGAGGAGAAAATGTGATTGATGATGCCAAGGCTCAAGTAGAGAGCATATGTCCTGGAATT
GTTTCGTGTGCTGACATTCTTGCAGTTGCAGCTCGTGATGCATCTGTTGCT
GCTGGTGGACCATCTTGGACAGTTAATCTTGGAAGAAGGGACTCCACTACTGCAAGCTTAGCCCAAGCT
AACAGCGATCTTCCTGGCTTTTCAGACCCCCTAAACAGGCTCATTTCTTTGTTCAGCGACAAAGGATTGAATGAAAGAGATATGGTTGCCCTTTCAG
GAGCTCATACTATCGGCCAAGCT
CAATGTGTAACATTCCGCGACAGGATATACAACAACGCAAGTGATATCGATCCTGACTTTGCTGCCACAAGAAGAGGCAATTGTCCACAAACTGGTGGCAATGGTAATCTTGCACCACTT
GATTTGGTCACACCCAATAATTTTGATAACAACTACTACAGCAACCTTATGGCAAAAAGAGGGCTTCTTGCGTCAGATCAAATACTTTTCAGTGGCGGATCTACAGACAGCATCGTTAAC
GAGTACAGCACAGACTCTTCATCTTTCGACTCTGATTTTGCTGCTGCTATGGTAAAGATGGGGAATATAAGTCCCTTAACTGGCACTCAAGGGGAGATTCGAAGGCTTTGCAGTGCTGTT
AAC

Retrieve as FASTA