Entry information : RcPrx83 (30190.m011149)
Entry ID 9404
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx83 (30190.m011149)
Name (synonym) RcPrx83 (30190.m011149)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx83
start..stop
S start..stop
RcPrx79 166 3.55e-52 3..109 192..311
RcPrx82 138 2.48e-41 3..101 194..295
RcPrx78 138 2.6e-41 3..101 197..298
MePrx29 121 7.54e-35 3..101 195..296
Gene structure Fichier Exons


exon

Literature and cross-references RcPrx83 (30190.m011149)
DNA ref. Phytozome 12:   30190 (2184337..2185522)
Protein sequence: RcPrx83 (30190.m011149)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   129
PWM (Da):   %s   14316.12  
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAHTFVGAKCFFFRNRVNGTGNNIDVRFASLIRDIIPCPADGSGSENLDALTPETWDNRYFRNLIETKGLLQSDQELYSGGSTNSIVEEYDRDVSIFRSDVNPITDPNAAGKKGLRGAN
RFVKRSFD

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' and 3' end are missing).
DNA
Send to BLAST
CDS
Send to BLAST