Entry information : RcPrx84 (30190.m011150)
Entry ID 9405
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx84 (30190.m011150)
Name (synonym) RcPrx84 (30190.m011150)
Class Class III peroxidase    [Orthogroup: Prx065]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx84
start..stop
S start..stop
RcPrx80 615 0 1..322 1..321
MePrx126 513 0 1..322 1..321
RcPrx85 506 0 1..322 1..320
MePrx109 489 3e-176 1..322 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2189650..2189871 222 N° 2 2189983..2190174 192 N° 3 2190324..2190489 166 N° 4 2190580..2190965 386
join(2189650..2189871,2189983..2190174,2190324..2190489,2190580..2190965)


exon

Literature and cross-references RcPrx84 (30190.m011150)
DNA ref. Phytozome 12:   30190 (2189650..2190965)
Protein sequence: RcPrx84 (30190.m011150)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (295)
PWM (Da):   %s   34148.64 (31127.1)  
PI (pH):   %s   4.53 (4.45) Peptide Signal:   %s   cut: 28 range:28-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRLSFACMILTIFFIINYSSLPCQAQLSSNFYDNTCPNALTTIKSAIDAAIESEQRMAASLIRLHFHDCFVQGCDGSVLLVDTPTFTGEKSARNNANSIRGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVNLGRRDSTTASLAQANSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFRDRIYNNASDIDPDFAATRRGNCPQTGGNGNLAPLDLVTPNNFDNNYYSNLIAKRGLLASDQILFSGGSTDSIVNEYSTDSSSFDSDFAAAMVKMGNISPLTGTQGEIRRICSAV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCGTTTATCTTTTGCTTGCATGATTTTAACGATTTTTTTTATCATTAATTATTCAAGCTTGCCATGTCAAGCGCAACTTTCTTCAAACTTCTATGACAATACATGTCCTAAC
GCGCTTACTACTATTAAGTCTGCTATTGATGCAGCAATAGAAAGTGAGCAGAGAATGGCTGCTTCGCTCATTCGTCTTCATTTCCATGATTGCTTTGTCCAG
GTAACCTGAGACCGCTTA
AGTTAATTATGATTAACTCTTAATATATGCATGCATGTTGAGGCTAGAGATTAGTACATACGTTAACTATATTTATAAATATATGTATTGCAGGGTTGTGATGGCTCAGTTTTGCTGGTG
GATACTCCCACATTTACTGGGGAGAAATCTGCACGTAACAACGCCAATTCTATCAGGGGAGAGAATGTGATTGATGATGCCAAGGCTCAAGTAGAGAGCATATGTCCTGGAATTGTTTCG
TGTGCCGACATTCTTGCAGTTGCAGCTCGTGATGCATCTGTTGCT
GTAAGTTTGTGCTTAATGATCTCCCTTTATAAAGAAGCAGTTGCCTCGTTTCGTGATAGCCCTATTCTTTCATGA
ATAGTCTTTACCAAGAAAATAAATGCTATAGCTAGCCTGAGCATTACTAAACATGGTCTCTGCGTATAAAACAGGCTGGTGGACCATCTTGGACAGTTAATCTTGGAAGAAGGGACTCCA
CTACTGCAAGCTTAGCCCAAGCTAACAGCGATCTTCCTGGCTTTTCAGACCCCCTAAACAGGCTCATTTCTTTGTTCAGCGACAAAGGATTGAATGAAAGAGATATGGTTGCCCTTTCAG
GTTCGCGTACCTCCTTACTTAATTGCCAATTTCAGTTATGAACTTCTATTATGTTATGACTAAAGAAACTTCATTGCCATATAAATACAGGAGCTCATACTATCGGCCAAGCTCAATGTG
TAACATTCCGCGACAGGATATACAACAACGCAAGTGATATCGATCCTGACTTTGCTGCCACAAGAAGAGGCAATTGTCCACAAACTGGTGGCAATGGTAATCTTGCACCACTTGATTTGG
TCACACCCAATAATTTTGATAACAACTACTACAGCAACCTTATCGCAAAAAGGGGGCTTCTTGCGTCAGATCAAATACTTTTCAGTGGCGGATCTACAGACAGCATCGTTAACGAGTACA
GCACAGACTCTTCATCTTTCGACTCTGATTTTGCTGCCGCTATGGTAAAGATGGGGAATATAAGTCCCCTAACTGGTACTCAAGGAGAGATTCGAAGGATTTGCAGTGCTGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCGTTTATCTTTTGCTTGCATGATTTTAACGATTTTTTTTATCATTAATTATTCAAGCTTGCCATGTCAAGCGCAACTTTCTTCAAACTTCTATGACAATACATGTCCTAAC
GCGCTTACTACTATTAAGTCTGCTATTGATGCAGCAATAGAAAGTGAGCAGAGAATGGCTGCTTCGCTCATTCGTCTTCATTTCCATGATTGCTTTGTCCAG
GGTTGTGATGGCTCAGTT
TTGCTGGTGGATACTCCCACATTTACTGGGGAGAAATCTGCACGTAACAACGCCAATTCTATCAGGGGAGAGAATGTGATTGATGATGCCAAGGCTCAAGTAGAGAGCATATGTCCTGGA
ATTGTTTCGTGTGCCGACATTCTTGCAGTTGCAGCTCGTGATGCATCTGTTGCT
GCTGGTGGACCATCTTGGACAGTTAATCTTGGAAGAAGGGACTCCACTACTGCAAGCTTAGCCCAA
GCTAACAGCGATCTTCCTGGCTTTTCAGACCCCCTAAACAGGCTCATTTCTTTGTTCAGCGACAAAGGATTGAATGAAAGAGATATGGTTGCCCTTTCAG
GAGCTCATACTATCGGCCAA
GCTCAATGTGTAACATTCCGCGACAGGATATACAACAACGCAAGTGATATCGATCCTGACTTTGCTGCCACAAGAAGAGGCAATTGTCCACAAACTGGTGGCAATGGTAATCTTGCACCA
CTTGATTTGGTCACACCCAATAATTTTGATAACAACTACTACAGCAACCTTATCGCAAAAAGGGGGCTTCTTGCGTCAGATCAAATACTTTTCAGTGGCGGATCTACAGACAGCATCGTT
AACGAGTACAGCACAGACTCTTCATCTTTCGACTCTGATTTTGCTGCCGCTATGGTAAAGATGGGGAATATAAGTCCCCTAACTGGTACTCAAGGAGAGATTCGAAGGATTTGCAGTGCT
GTTAAC

Retrieve as FASTA