Entry information : SiAPx02 (Si030912m)
Entry ID 9431
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiAPx02 (Si030912m)
Name (synonym) SiAPx02 (Si030912m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiAPx02
start..stop
S start..stop
ZmAPx02_B73 498 0 1..250 1..250
SbAPx02 497 0 1..250 1..250
ZmAPx02_H99 494 2e-180 1..250 1..250
HvAPx03 475 7e-173 3..250 4..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49110059..49110177 119 N° 2 49109811..49109985 175 N° 3 49109662..49109727 66 N° 4 49108824..49108872 49
N° 5 49108300..49108385 86 N° 6 49108133..49108212 80 N° 7 49107827..49107929 103 N° 8 49107684..49107742 59
N° 9 49107558..49107573 16  
complement(join(49107558..49107573,49107684..49107742,49107827..49107929,4910813 3..49108212,49108300..49108385,49108824..49108872,49109662..49109727,49109811..4 9109985,49110059..49110177))


exon

Literature and cross-references SiAPx02 (Si030912m)
DNA ref. Phytozome 12:   scaffold_2 (49110177..49107558)
Protein sequence: SiAPx02 (Si030912m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27143.72  
PI (pH):   %s   5.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKAYPTVSEDYLKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVGTKTGGPFGTMKDPAELAHGANAGLDIAVRLLEPIKEQFPTISYADFYQLAGVVAVEVTGGPDVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPLVEKYAADEDAFFADYAEAHLKLSELGFAEA*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCCTACCCCACGGTCAGCGAGGACTACCTCAAGGCGATCGACAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAACTGCGCCCCGCTCATGCTCCGCCTCGCG
TAAGCCGCCTCCCCCAACCGCCCCATTCCCCGATCTGGCTTGTGCTTCTCACCTCCCACTCACCCCTCGCAGCTGGCACTCCGCTGGCACCTTCGATGTCGGCACCAAGACAGGGGGCCC
CTTCGGCACCATGAAGGACCCCGCCGAGCTGGCGCACGGAGCCAACGCTGGACTCGACATCGCCGTCAGGCTGCTCGAGCCCATCAAGGAGCAGTTCCCCACCATATCCTACGCTGACTT
CTACCAG
GTTACCTGCCCGCCCGCCCGCCTGCTCAGATTGCGGTTTCTATTCCAGATCGAGTAACAACTTTCCCTCTTACGGCGCTGCAGCTCGCCGGAGTCGTTGCCGTTGAGGTCACC
GGCGGCCCTGATGTCCCCTTCCACCCAGGGAGGCAG
GTCAGACATATTCCTTCTTCCTTTTATCATCACACAAATCGTGCTCCTGCCCAAACCCAACCCACCACGACCCAGAGATTTTGC
TAGGGTTTAAGCAAGCAGACCTTATTCTCTGCCTACCAACTGCACCTGCGTAGTTGACATGCAGATGTGCGGGATTATTGTCTTTGTTCAAAAGCTCTGCATTCATGTGATGCTAATTAT
TTGCAATCCCTTATTATGTTGGTTGGTTGTACTGTTGATGGATTGGCAATTCCTAGATTAAGTGTCTACATCACATTCCTGTACTCTAGGGCCTAGATATGACATGTAAAAATTCTGGTG
ATGCTGTGTTGGTTTTGCCAAGCAAAATTGCCCTGATTACATTATCAGTGCATTTCATGAGAGAGCAGTAATCATAAGGTGATAATGGAGCCAATTGATCTTCTGCGTAGGCCCATATGC
CTTTAAATGCAATTATTGCATGTTCGTTTCATGTATTGCTCATTCTACCGATGTAACAATTATTCACTGGCCCAGGTTCAAGCAGATAATAAGCATGCAATTAGTAATGAGCTACATCTC
TTGTCTTATAACTTGTAAGATATTGTCGCCTAGGACTCTTGCCTTCCGTTAATAGTATTTGTATTTGTATTTGCTCGTTATCGACGTTACATGACCTCAAAAAAAAAGACGTTACATTAT
CTCCCATTGGGAATATGTTATTATGCATTGATTTAGACTTGCTGTTTCTTTACTTTATTTTTCATCTAGATGTGGATGTTGATGAAATCATTGTTTATTCTGTAGGACAAGCCTGAGCCT
CCACCAGAAGGCCGCCTTCCTGATGCCACCCAAG
GTACAGTTAGAAAATGCCTCTGATATTACTGAAATTCTGGCGTCATATTATGCTAATTGTATTCTATTGATGTGGAAAAGGTTTCA
AAATAATTCCTTCCTTTTCAAATAGGACCATTTAGCAACTAGAGTTGCAGTAGCAAGTATTTGATTACGATTTCTTGCATTTTGTGATACAATTTTTTTAATCTGTTTTCATGTTGGGAG
TCTTGTTCCACAGCGTTTGCGTGCTTCTGGGTGCATTATGTGGCATCCTTCTTTTGAAAAAACGAACACCTCAATTGATGTAAAATGCTTAAACATTATCTAACTTAAGTGTTCATGGAT
TGCCTTCTTTGTTGTGTCAAGGATGAAGTGAGAAAAAATTTGTTAATTATATTTGTCATCAATTGGTAGGAATGTGATAGATGGACTTACTGGTTGGGGTCTCTTGTATCAGGTTCGGAC
CACCTTAGGCAGGTGTTCTCCACACAGATGGGTTTGAGTGACCAGGACATTGTTGCGCTTTCTGGTGGTCACACTCTG
GTTTGTTGAATTGTTTTATAGTCTCTGTATTTTTGTGCTAGA
GAACTTAACAGGTTGTGCTTATGCATAATTGACTGTCACTTGTAGGGAAGATGCCACAAGGATAGGTCTGGCTTTGAGGGAGCCTGGACTTCCAACCCTTTGATCTTTGACAACTCGTAC
TTCAA
GTAAGTGAGGTGTTTCTTTCAAAAGGAGACTCTTATTTCTAGTCGTTCCGTGTTTTGCTGCTTAAACTGAAAGTTAATTAGCTTTTTTTCCTTACTGGGAAAGTGAGGGCTCTAT
TGATTGAGTAATGGCCTTATTACAATCCTGGAGCACGAACTCCTTGACATAGGTGTTATTAAAGTTGTCTCCACGAAGTTATTGACAGGGAGCTCCTGAGTGGTGAGAAGGAAGGCCTTC
TGCAGCTGCCAAGTGACAAAGCCCTCCTTTCTGACCCATCCTTCCGCCCCCTTGTTGAGAAATACGCAGCG
GTATATATTTGATCCTTGCACCTTGTTGGAGATTTCAGCTCACCCTTGA
AAGTTCTAACCTGGAATATTTTGCCCGGTTTGTAGGATGAGGACGCCTTCTTTGCTGACTATGCTGAGGCCCACCTGAAGCTTTCTGAATTGGGGTAAGTCGTGGTGGAAGGTCCAGGCC
ACGAAGAACGCTTGTTTGCTACTACTGTTTGAACACTAAGGCAGATGGCAGAGCAGTAATGTGGATATGTTTTCTTGATTGCAGATTTGCTGAGGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCCTACCCCACGGTCAGCGAGGACTACCTCAAGGCGATCGACAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAACTGCGCCCCGCTCATGCTCCGCCTCGCC
TGGCACTCCGCTGGCACCTTCGATGTCGGCACCAAGACAGGGGGCCCCTTCGGCACCATGAAGGACCCCGCCGAGCTGGCGCACGGAGCCAACGCTGGACTCGACATCGCCGTCAGGCTG
CTCGAGCCCATCAAGGAGCAGTTCCCCACCATATCCTACGCTGACTTCTACCAG
CTCGCCGGAGTCGTTGCCGTTGAGGTCACCGGCGGCCCTGATGTCCCCTTCCACCCAGGGAGGCAG
GACAAGCCTGAGCCTCCACCAGAAGGCCGCCTTCCTGATGCCACCCAAGGTTCGGACCACCTTAGGCAGGTGTTCTCCACACAGATGGGTTTGAGTGACCAGGACATTGTTGCGCTTTCT
GGTGGTCACACTCTG
GGAAGATGCCACAAGGATAGGTCTGGCTTTGAGGGAGCCTGGACTTCCAACCCTTTGATCTTTGACAACTCGTACTTCAAGGAGCTCCTGAGTGGTGAGAAGGAA
GGCCTTCTGCAGCTGCCAAGTGACAAAGCCCTCCTTTCTGACCCATCCTTCCGCCCCCTTGTTGAGAAATACGCAGCG
GATGAGGACGCCTTCTTTGCTGACTATGCTGAGGCCCACCTG
AAGCTTTCTGAATTGGG
ATTTGCTGAGGCGTAA

Retrieve as FASTA