Entry information : SiPrx05 (Si001988m)
Entry ID 9439
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx05 (Si001988m)
Name (synonym) SiPrx05 (Si001988m)
Class Class III peroxidase    [Orthogroup: Prx126]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx05
start..stop
S start..stop
SbPrx60 557 0 14..359 18..371
ZmPrx01 550 0 24..359 26..367
TaPrx31-1D 491 7.94e-176 4..359 2..348
BdiPrx62 484 3.61e-173 31..359 25..356
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9439' 'join(13995325..13995552,13997308..13997748,13997829..13998239)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13995325..13995552 226 N° 2 13997308..13997748 439 N° 3 13997829..13998239 409  
join(13995325..13995552,13997308..13997748,13997829..13998239)


exon

Literature and cross-references SiPrx05 (Si001988m)
DNA ref. Phytozome 12:   scaffold_5 (13995325..13998239)
Protein sequence: SiPrx05 (Si001988m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (328)
PWM (Da):   %s   37313.73 (34147.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.5 (5.13) Peptide Signal:   %s   cut: 32 range:32-359
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAARQGKPAAGGVALLVALAVWLLPAVARAQLRVGFYDTTCPNAEALVRQAVAAAFARDAGTAAGLIRLHFHDCFGCDASVLLTVNPGGGQTERDAAPNNPSLRGFDVIDAAKAAVEQS
CPRTVSCADIVAFAARDSAALTGSVSYQVPAGRRDGHVSNASDTVDLPPPTSTAKELTDLFAAKNLSVEDMVVLSGAHTVGRSFCESFVDRVWNRSAKPPAAIVDAGLSSSYASLLRALC
PSNTTRATPITTAMDPGTPNVLDNNYYKLLPRGMGLFFSDNQLRVDTAMAALVSSFAANETLWKEKFAAAMVKMGRIQVQTGTCGEVRLNCSVVNPSSSTIELGSSAPAADEDGGVATS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCCGCTAGGCAAGGCAAGCCGGCGGCCGGAGGAGTGGCCCTGCTGGTGGCCCTCGCCGTGTGGCTCCTGCCGGCGGTGGCCCGCGCGCAGCTCCGGGTGGGGTTCTACGACACC
ACCTGCCCCAACGCCGAGGCGCTCGTCCGCCAGGCCGTCGCCGCCGCCTTCGCCAGGGACGCCGGCACCGCCGCGGGCCTCATCCGCCTCCATTTCCACGACTGCTTC
TCGTCAGGTAAC
GAAACTTCAGCTTTATACCACCTGCGGCTTTATTTAAACATGAAAAGGTGCGTCGTCCGTTTAAAAAGTTTTGACATGGTGCCCATGCAACGCAATGCTTTAAATTGAAACATACGAATG
CAACGCGATCTGATGTATTTAGTAACTTATTTAGGTTCAGTAATTAAGAACGAGCGTCTGCGTTAGCTAGGATGCATGATAAACTCACTACGTACAGTTACCCAATAAATGAGCGGGGAA
ACAATTCAGTACTTAAGAAAAAAACAGAGTTCTTCTTCCGTGTATAATGTACATGAGATGTAGCGTTGAAAGGCGACATGGATCAAATTGCTCTTATGCACATAATTAATTTCATGAGAT
TTTCCATCATGCTTTCTCTGTTAGATTTTTTTCTCCCTAGTATTCCCAGTTAATTGCATGAAAAAGTTACCCATATTTCATTTTAGTTCCATGTTACGGAAAGTTACAAAAAAAAAACTC
ACCGTAGTTATTAGTTTTCATCGTAAACCCTCCTACAAGAGTATTAGAGACTTGGCGATTAAAATCAACTTGATTTAAGTGGATGAATTAAAGTTCTCCAAATTTTGAGTGAGATGATCC
TGTAATATCTTTAGTCTCTATGTTGGTTCCCGATCCTTTGTGGTTGAAAGAAATGAGCTACACATTCAGGATGTATTAGTGTATAATGACCCAGCCCGACAACATGAGCTTCCTCTGCTT
TTCAGTTCTATCCCCTAGCTTGACATTGAGTCCATGAGTTTTCGAATGAACTTAGCAATAAAAGGCAAGATATGACACTGTTCTTATCAACATTATATAGGGGTATCTATTTGTAATAGA
TCCATATCTCACAATACTAGTTTACACAAATTTGGGGACACCATTTGTAATGGGAAAGAAGTAGAAGGAGAAAGCTGTCTCTTGAGACAAAGAGACAAAGCGTCAAAAGCACAAAAGCTC
CGAAAGCAAGTGAACGGCATATATGCATGCTCTGATGTTTTCTTTCTTGGAAGGCAACGCATATTCCCTGCTTGCAAATGTCGCCAGGAATGACCTTTCAGCAGAAGAATCTCACTGATC
TTTATCTTTTTTCCTCCCCATGCTCACATGCATGGATGATCGTACCAAAAGACAGTCAAAGTCAAGGACACATGCACAAATATGTTTCCTAGCTAGCTAGTATCTTCTCTTTAGTAACAA
AAGCATGGACCATTCTCCCTTGCAAACTTCAGAAACAATGTATAGGCACAGTTGCTTTGAAATAACTAATAATCTATTTGTATATCTGTAGTAGGACACAAAGAAATAACCTTTGATCAT
CGATACAAAAAGACATCTTGAAGATATTTTCGTTAAAGCAACCCAAAACCGGACTATTCCACAGATTCAACTGATTTTGAGCAGAAGGATGCTGAACGACCATCTGATCTTGTATTCCAT
ATTATTAGGTCAGTTAGTTTGGTTCAACTATCTGATCAATCGTCGTCTCATTCCATCCAAGGATGACATGATCTGTAAATCAAACAGCTTGTTAGAAAAAACTCTCCGAAAAATTAAGAA
ACCTGAAATTTAACTGGTTTGATTGAGTAATATGACACCAGACAACCATATGATCTTGTATGCCGTGCGATATCAGCAAGTTCATTAGTTTGGTTCCATGAAGAGGTTGATCAACCCTCA
TCTTTTTTTTTTATTATAACATTGACTGATTGACATGCGTCTTTTATAACACTACTACAATGCAGGGCTGTGATGCTTCGGTGCTCCTGACCGTGAACCCCGGCGGCGGGCAAACGGAGC
GTGACGCCGCCCCGAACAACCCGAGCCTCCGCGGCTTCGACGTGATCGACGCCGCCAAGGCCGCCGTGGAGCAGAGCTGCCCGCGCACCGTCTCGTGCGCCGACATCGTCGCCTTTGCCG
CCCGCGACAGCGCCGCCCTCACCGGCAGCGTCTCGTACCAGGTCCCGGCGGGGCGGCGCGACGGCCACGTGTCCAACGCGTCGGACACCGTCGACCTTCCCCCGCCCACGTCCACGGCCA
AGGAGCTCACCGACCTGTTCGCCGCCAAGAACCTCAGTGTCGAGGACATGGTCGTCCTCTCCGGCGCCCACACCGTTGGCCGCTCCTTCTGCGAATCCTTCGTCGACCGCGTCTGGAACC
GGAGCGCCAAGCCCCCGGCCGCAATC
TCGTACGCCGCCGCCGCCGCCATGCTCGAGCTTGCTCTCTTGCTGCAGTATTACATATATAATATATATAATATGTATGCAGGTGGACGCGGGG
CTGAGCTCGTCGTACGCGTCGCTGCTGCGGGCGCTGTGCCCGTCGAACACGACGCGGGCGACGCCGATCACGACGGCGATGGACCCCGGGACGCCCAACGTGCTGGACAACAACTACTAC
AAGCTCCTCCCGCGCGGCATGGGGCTCTTCTTCTCCGACAACCAGCTGCGCGTGGACACGGCGATGGCGGCGCTGGTGAGCAGCTTCGCGGCGAATGAGACGCTGTGGAAGGAGAAGTTC
GCGGCGGCGATGGTGAAGATGGGACGCATCCAGGTGCAGACCGGGACGTGCGGGGAGGTCCGCCTCAACTGCAGCGTCGTCAACCCGTCGTCGTCGACCATCGAGCTGGGCTCGAGCGCG
CCGGCCGCCGACGAGGATGGCGGCGTCGCCACGAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCCGCTAGGCAAGGCAAGCCGGCGGCCGGAGGAGTGGCCCTGCTGGTGGCCCTCGCCGTGTGGCTCCTGCCGGCGGTGGCCCGCGCGCAGCTCCGGGTGGGGTTCTACGACACC
ACCTGCCCCAACGCCGAGGCGCTCGTCCGCCAGGCCGTCGCCGCCGCCTTCGCCAGGGACGCCGGCACCGCCGCGGGCCTCATCCGCCTCCATTTCCACGACTGCTTC
GGCTGTGATGCT
TCGGTGCTCCTGACCGTGAACCCCGGCGGCGGGCAAACGGAGCGTGACGCCGCCCCGAACAACCCGAGCCTCCGCGGCTTCGACGTGATCGACGCCGCCAAGGCCGCCGTGGAGCAGAGC
TGCCCGCGCACCGTCTCGTGCGCCGACATCGTCGCCTTTGCCGCCCGCGACAGCGCCGCCCTCACCGGCAGCGTCTCGTACCAGGTCCCGGCGGGGCGGCGCGACGGCCACGTGTCCAAC
GCGTCGGACACCGTCGACCTTCCCCCGCCCACGTCCACGGCCAAGGAGCTCACCGACCTGTTCGCCGCCAAGAACCTCAGTGTCGAGGACATGGTCGTCCTCTCCGGCGCCCACACCGTT
GGCCGCTCCTTCTGCGAATCCTTCGTCGACCGCGTCTGGAACCGGAGCGCCAAGCCCCCGGCCGCAATC
GTGGACGCGGGGCTGAGCTCGTCGTACGCGTCGCTGCTGCGGGCGCTGTGC
CCGTCGAACACGACGCGGGCGACGCCGATCACGACGGCGATGGACCCCGGGACGCCCAACGTGCTGGACAACAACTACTACAAGCTCCTCCCGCGCGGCATGGGGCTCTTCTTCTCCGAC
AACCAGCTGCGCGTGGACACGGCGATGGCGGCGCTGGTGAGCAGCTTCGCGGCGAATGAGACGCTGTGGAAGGAGAAGTTCGCGGCGGCGATGGTGAAGATGGGACGCATCCAGGTGCAG
ACCGGGACGTGCGGGGAGGTCCGCCTCAACTGCAGCGTCGTCAACCCGTCGTCGTCGACCATCGAGCTGGGCTCGAGCGCGCCGGCCGCCGACGAGGATGGCGGCGTCGCCACGAGCTAA

Retrieve as FASTA