Entry information : SiPrx08 (Si002047m)
Entry ID 9442
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx08 (Si002047m)
Name (synonym) SiPrx08 (Si002047m)
Class Class III peroxidase    [Orthogroup: Prx092]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx08
start..stop
S start..stop
ZmPrx107 660 0 1..348 1..348
ZmPrx44 655 0 1..348 1..348
SbPrx58 653 0 1..348 1..348
SiPrx09 649 0 1..348 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2868635..2868862 228 N° 2 2869033..2869851 819  
join(2868635..2868862,2869033..2869851)


exon

Literature and cross-references SiPrx08 (Si002047m)
DNA ref. Phytozome 12:   scaffold_5 (2868635..2869851)
Protein sequence: SiPrx08 (Si002047m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (320)
PWM (Da):   %s   38182.54 (35348.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.78 (6.64) Peptide Signal:   %s   cut: 29 range:29-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSAAVLLALVAVQAAVLLAAVPSAQAGELQVGYYNKKCKGLENVVKWNVIKALKANRRTGAALIRLLFHDCFVRGCDGSVLLDASYDNPHPEKEAPVNIGLAAFDLLEEIKAAVEKRCPGVVSCSDLLIYAARDAASILSNGHVHFDVPAGRLDGFVSKAEEAQAELPDSAHDAQKLIDNFARKNFTVEELVILSGAHSIGQGHCSSFTGRLSEPANQITPAYRNLLNYKCPQGSNPTVDNNVRDEDYDVVARFMPGFVSRVRKIPDFLDNSYYHNNLAKIVTFHSDWTLLTHKEAFGHVKEYAENGTLWDEDFAESLVKLSELPMPAGSKGEIRKKCSVINHRLY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCTGTGCTCCTCGCCCTTGTGGCCGTCCAGGCGGCAGTGCTCCTCGCCGCCGTGCCGTCGGCGCAGGCCGGCGAGCTGCAGGTCGGGTACTACAACAAGAAATGC
AAGGGCCTGGAGAACGTCGTCAAGTGGAACGTCATCAAGGCGCTCAAGGCCAACCGCCGCACCGGCGCCGCGCTCATCCGCCTCCTCTTCCATGATTGCTTCGTCAGG
GTAGGCACACTT
GCATGATGCATATATGCCATTCATCACATGCTGATCTCACCTAAACTAGCTAGTTCAATTATGTGTGGTGAAATGTACGTAGTCAGTAACTATACATACAAAATTAGACCTGAAAGTTAA
TGAGGTGTAATAGTTTCCATAACCATGGCACCATGCAGGGTTGCGATGGCTCTGTCCTCCTGGACGCGTCCTACGACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGCCTCG
CCGCCTTCGACCTCCTGGAGGAGATCAAGGCTGCCGTGGAGAAGAGGTGCCCCGGCGTCGTCTCCTGCTCCGACCTCCTCATCTACGCCGCCCGCGACGCGGCCAGCATCCTCAGCAACG
GCCACGTCCACTTCGACGTCCCGGCCGGCCGCCTCGATGGCTTCGTCTCTAAGGCCGAAGAAGCCCAGGCGGAGCTCCCAGATTCCGCCCATGACGCGCAGAAGCTCATCGACAACTTCG
CCAGGAAGAACTTCACCGTCGAGGAGCTCGTCATCCTCTCCGGCGCGCACTCCATCGGCCAGGGCCACTGCTCGTCCTTCACCGGCCGCCTCTCTGAGCCAGCGAACCAGATCACCCCGG
CCTACCGCAACCTGCTCAACTACAAGTGCCCCCAGGGCTCCAACCCGACCGTGGACAACAACGTCCGCGACGAGGACTACGACGTCGTGGCGAGGTTCATGCCGGGGTTCGTCAGCCGGG
TGCGCAAGATCCCCGACTTCCTTGACAACTCGTACTACCACAACAACCTCGCCAAGATCGTCACCTTCCACTCCGACTGGACGCTGCTGACGCACAAGGAGGCGTTCGGCCATGTCAAGG
AGTACGCCGAGAACGGCACGCTCTGGGACGAGGACTTCGCCGAGTCGCTGGTTAAGCTCAGCGAGCTGCCCATGCCGGCCGGGAGCAAGGGCGAGATCAGGAAGAAGTGCAGCGTCATCA
ACCACCGCCTGTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCTGTGCTCCTCGCCCTTGTGGCCGTCCAGGCGGCAGTGCTCCTCGCCGCCGTGCCGTCGGCGCAGGCCGGCGAGCTGCAGGTCGGGTACTACAACAAGAAATGC
AAGGGCCTGGAGAACGTCGTCAAGTGGAACGTCATCAAGGCGCTCAAGGCCAACCGCCGCACCGGCGCCGCGCTCATCCGCCTCCTCTTCCATGATTGCTTCGTCAGG
GGTTGCGATGGC
TCTGTCCTCCTGGACGCGTCCTACGACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGCCTCGCCGCCTTCGACCTCCTGGAGGAGATCAAGGCTGCCGTGGAGAAGAGGTGC
CCCGGCGTCGTCTCCTGCTCCGACCTCCTCATCTACGCCGCCCGCGACGCGGCCAGCATCCTCAGCAACGGCCACGTCCACTTCGACGTCCCGGCCGGCCGCCTCGATGGCTTCGTCTCT
AAGGCCGAAGAAGCCCAGGCGGAGCTCCCAGATTCCGCCCATGACGCGCAGAAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCGTCGAGGAGCTCGTCATCCTCTCCGGCGCGCAC
TCCATCGGCCAGGGCCACTGCTCGTCCTTCACCGGCCGCCTCTCTGAGCCAGCGAACCAGATCACCCCGGCCTACCGCAACCTGCTCAACTACAAGTGCCCCCAGGGCTCCAACCCGACC
GTGGACAACAACGTCCGCGACGAGGACTACGACGTCGTGGCGAGGTTCATGCCGGGGTTCGTCAGCCGGGTGCGCAAGATCCCCGACTTCCTTGACAACTCGTACTACCACAACAACCTC
GCCAAGATCGTCACCTTCCACTCCGACTGGACGCTGCTGACGCACAAGGAGGCGTTCGGCCATGTCAAGGAGTACGCCGAGAACGGCACGCTCTGGGACGAGGACTTCGCCGAGTCGCTG
GTTAAGCTCAGCGAGCTGCCCATGCCGGCCGGGAGCAAGGGCGAGATCAGGAAGAAGTGCAGCGTCATCAACCACCGCCTGTACTAA

Retrieve as FASTA