Entry information : SiPrx100 (Si022693m)
Entry ID 9445
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx100 (Si022693m)
Name (synonym) SiPrx100 (Si022693m)
Class Class III peroxidase    [Orthogroup: Prx052]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx100
start..stop
S start..stop
SiPrx101 536 0 1..318 1..317
SbPrx124 511 0 1..318 1..323
SbPrx122 496 4e-179 24..316 33..325
SbPrx120 493 1e-177 31..314 34..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19550210..19550647 438 N° 2 19549952..19550114 163 N° 3 19549463..19549818 356  
complement(join(19549463..19549818,19549952..19550114,19550210..19550647))


exon

Literature and cross-references SiPrx100 (Si022693m)
DNA ref. Phytozome 12:   scaffold_3 (19550647..19549463)
Protein sequence: SiPrx100 (Si022693m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (287)
PWM (Da):   %s   34000.01 (31031.5) Transmb domain:   %s   i13-35o
PI (pH):   %s   5.37 (4.99) Peptide Signal:   %s   cut: 32 range:32-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSRSASLGLLVAAHCALLLALAGGASAGGVALSSTFYDASCPTAYDVVRRVIQNARVSDPRIPASLIRLHFHDCFVQGCDGSLLLDDDLPTIQTEKNVLANNNSARGFPVVDDIKAALEHACPGIVSCADILALAAEISVELAGGPRWSGLLGRRDGTTTNVESANNLPSPFDSLNVLQEKFRNFNLDDTDLVALQGAHTFGKVQCQFTRENCTAGQREGDLKNLDQVTPDLFDNKYYGNLLEGRAQLPSDEVMLSDPTAAATTAPVVQRFAGNQQDFFRNFAASMIKMGNISPLTGKDGEIRKNCRRVNSRGY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCGCTTCCTCTCGCTCCGCTTCTCTTGGGCTGCTGGTAGCCGCGCACTGCGCCCTCCTCCTCGCCTTGGCTGGCGGCGCTAGTGCCGGTGGCGTGGCGCTGAGCTCCACGTTC
TACGACGCGTCGTGCCCCACCGCCTACGACGTCGTCCGGCGCGTCATCCAGAACGCGCGCGTCTCAGACCCGCGCATCCCGGCCAGCCTCATCCGCCTCCACTTTCACGACTGCTTCGTC
CAGGGCTGCGACGGCTCGCTCCTCCTTGACGACGACCTCCCGACGATCCAGACCGAGAAGAACGTGCTTGCCAACAACAACTCGGCGCGCGGCTTTCCCGTGGTCGACGACATCAAGGCC
GCGCTGGAGCACGCGTGTCCCGGCATCGTCTCCTGCGCTGATATCCTCGCCCTAGCGGCTGAGATCTCCGTCGAACTC
GTAAGTAACGCGATCTTCTTGCATTGGTCGGCACAGCGCCTC
CTAGCTTCTCTCAGTCCTCACATGAACTCACGAAATCACGGACATGGGCGCAGGCAGGAGGGCCACGATGGAGCGGGCTGCTCGGCCGGCGAGACGGCACGACGACCAACGTCGAGAGCG
CCAACAACCTCCCGAGCCCTTTCGACTCCCTGAACGTTCTCCAGGAGAAGTTCAGAAACTTCAACCTCGACGACACTGACCTCGTCGCCCTCCAAG
GTAACGTAAACATACCAAGTCAAA
CCATTTCAGTTTTTAGCAATGTAATTTTGTATACAGTTCGAACGATCCTAGAAGATTTTTTCTATGTTGTGTACACACTGATTTTAACATTACACTTCTACTACTCCAGGAGCGCACACG
TTCGGCAAAGTGCAGTGCCAGTTCACGCGGGAGAACTGCACGGCCGGGCAGCGTGAGGGTGACCTGAAGAACCTGGATCAGGTCACACCCGACCTGTTCGACAACAAGTATTACGGCAAC
CTGTTGGAGGGCCGCGCCCAGCTCCCCTCCGACGAGGTCATGCTGTCCGACCCCACCGCGGCGGCAACCACCGCTCCCGTTGTTCAGCGGTTCGCAGGCAACCAACAGGATTTCTTCAGG
AACTTCGCGGCGTCCATGATTAAGATGGGCAACATCAGCCCCTTAACAGGGAAGGATGGAGAGATCAGGAAGAACTGCCGGAGAGTCAATAGCAGAGGGTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCGCTTCCTCTCGCTCCGCTTCTCTTGGGCTGCTGGTAGCCGCGCACTGCGCCCTCCTCCTCGCCTTGGCTGGCGGCGCTAGTGCCGGTGGCGTGGCGCTGAGCTCCACGTTC
TACGACGCGTCGTGCCCCACCGCCTACGACGTCGTCCGGCGCGTCATCCAGAACGCGCGCGTCTCAGACCCGCGCATCCCGGCCAGCCTCATCCGCCTCCACTTTCACGACTGCTTCGTC
CAGGGCTGCGACGGCTCGCTCCTCCTTGACGACGACCTCCCGACGATCCAGACCGAGAAGAACGTGCTTGCCAACAACAACTCGGCGCGCGGCTTTCCCGTGGTCGACGACATCAAGGCC
GCGCTGGAGCACGCGTGTCCCGGCATCGTCTCCTGCGCTGATATCCTCGCCCTAGCGGCTGAGATCTCCGTCGAACTC
GCAGGAGGGCCACGATGGAGCGGGCTGCTCGGCCGGCGAGAC
GGCACGACGACCAACGTCGAGAGCGCCAACAACCTCCCGAGCCCTTTCGACTCCCTGAACGTTCTCCAGGAGAAGTTCAGAAACTTCAACCTCGACGACACTGACCTCGTCGCCCTCCAA
G
GAGCGCACACGTTCGGCAAAGTGCAGTGCCAGTTCACGCGGGAGAACTGCACGGCCGGGCAGCGTGAGGGTGACCTGAAGAACCTGGATCAGGTCACACCCGACCTGTTCGACAACAAG
TATTACGGCAACCTGTTGGAGGGCCGCGCCCAGCTCCCCTCCGACGAGGTCATGCTGTCCGACCCCACCGCGGCGGCAACCACCGCTCCCGTTGTTCAGCGGTTCGCAGGCAACCAACAG
GATTTCTTCAGGAACTTCGCGGCGTCCATGATTAAGATGGGCAACATCAGCCCCTTAACAGGGAAGGATGGAGAGATCAGGAAGAACTGCCGGAGAGTCAATAGCAGAGGGTACTGA

Retrieve as FASTA