Entry information : SiPrx102 (Si024230m)
Entry ID 9447
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx102 (Si024230m)
Name (synonym) SiPrx102 (Si024230m)
Class Class III peroxidase    [Orthogroup: Prx083]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx102
start..stop
S start..stop
SiPrx106 604 0 4..325 2..322
SbPrx110 561 0 1..328 3..333
ZmPrx128 542 0 1..328 5..337
OsPrx68 425 1.66e-150 25..323 31..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9447' 'complement(join(3341302..3342057,3342168..3342398))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3342168..3342398 229 N° 2 3341302..3342057 754  
complement(join(3341302..3342057,3342168..3342398))


exon

Literature and cross-references SiPrx102 (Si024230m)
DNA ref. Phytozome 12:   scaffold_3 (3342398..3341302)
Protein sequence: SiPrx102 (Si024230m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   34805.33 (31966.9) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.13 (7.68) Peptide Signal:   %s   cut: 29 range:29-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATATSACNAMLLMAFVVAAALSTPSRAQSPLQYNFYANSCPQAEATVRNVTEGIIAKDRTMGAAFMRLFFHDCFVRGCDASILLDPTANNTQVEKKAIALRGYDAVNKIKAAVESDCPG
VVSCADILAFAARDSAVVSGGFASFAMPSGRRDGTVSNFIEVLQNIPSPIFKLQELIKNFAAKGLSIDDLVTLSAAHSFGQAHCSFVNGRLYPTVDPTMNATYADTLKTVCPPPGSNGGD
PVINNNRVTDPNVLSNQYYSNLVTGQVLFVSDQQLMNSSYTAAKVANNSADAATWMGQFAAALVKMGRIQVLTGTAGQVRKYCNVVKS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGGCGACATCAGCATGCAACGCCATGCTTCTCATGGCGTTCGTCGTGGCTGCTGCGCTGAGCACGCCGTCGCGGGCACAGTCGCCGCTGCAGTACAACTTCTACGCCAACTCG
TGCCCGCAAGCTGAGGCGACGGTGCGCAACGTCACCGAGGGGATCATCGCCAAGGACCGCACCATGGGCGCCGCCTTCATGCGCCTCTTCTTCCACGACTGCTTTGTTAGG
GTAACTACT
ATTGATGATTGATATGGATGCATTAATTAGATGTCAAAAATATGTTATTAGCATGCATCCGTATGCACACATGTCAACGAGTAGAGATTTTGGTTTTGCAGGGGGCTGCGACGCTTCCAT
TCTGCTCGACCCGACCGCCAACAACACGCAGGTGGAGAAGAAGGCGATCGCGCTGCGCGGCTACGACGCCGTGAACAAGATCAAGGCCGCCGTGGAGTCCGACTGCCCCGGCGTGGTCTC
CTGCGCCGACATCCTCGCCTTCGCGGCGCGGGACTCGGCCGTCGTCTCCGGCGGCTTCGCCAGCTTCGCCATGCCCTCGGGCCGCCGCGACGGAACCGTCTCCAACTTCATCGAGGTGCT
CCAGAACATCCCATCCCCGATCTTCAAGCTCCAGGAGCTCATCAAGAACTTCGCCGCCAAAGGCTTGAGCATCGACGACCTCGTCACGCTCTCCGCCGCGCACTCCTTCGGGCAGGCGCA
CTGCTCCTTCGTCAACGGCCGACTGTACCCGACCGTGGACCCGACCATGAACGCCACCTACGCTGATACTCTGAAGACGGTGTGCCCCCCGCCGGGCAGCAATGGCGGCGACCCGGTGAT
CAACAACAACCGCGTCACGGACCCGAACGTGCTGAGCAACCAGTACTACAGCAACCTGGTGACCGGGCAGGTGCTCTTCGTGTCGGACCAGCAGCTCATGAACAGCAGCTACACGGCGGC
CAAGGTGGCCAACAACTCCGCGGACGCTGCGACATGGATGGGGCAGTTTGCCGCGGCGCTGGTGAAGATGGGGCGCATCCAGGTGCTCACAGGGACCGCCGGTCAGGTCAGGAAGTACTG
CAACGTCGTCAAAAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGGCGACATCAGCATGCAACGCCATGCTTCTCATGGCGTTCGTCGTGGCTGCTGCGCTGAGCACGCCGTCGCGGGCACAGTCGCCGCTGCAGTACAACTTCTACGCCAACTCG
TGCCCGCAAGCTGAGGCGACGGTGCGCAACGTCACCGAGGGGATCATCGCCAAGGACCGCACCATGGGCGCCGCCTTCATGCGCCTCTTCTTCCACGACTGCTTTGTTAGG
GGCTGCGAC
GCTTCCATTCTGCTCGACCCGACCGCCAACAACACGCAGGTGGAGAAGAAGGCGATCGCGCTGCGCGGCTACGACGCCGTGAACAAGATCAAGGCCGCCGTGGAGTCCGACTGCCCCGGC
GTGGTCTCCTGCGCCGACATCCTCGCCTTCGCGGCGCGGGACTCGGCCGTCGTCTCCGGCGGCTTCGCCAGCTTCGCCATGCCCTCGGGCCGCCGCGACGGAACCGTCTCCAACTTCATC
GAGGTGCTCCAGAACATCCCATCCCCGATCTTCAAGCTCCAGGAGCTCATCAAGAACTTCGCCGCCAAAGGCTTGAGCATCGACGACCTCGTCACGCTCTCCGCCGCGCACTCCTTCGGG
CAGGCGCACTGCTCCTTCGTCAACGGCCGACTGTACCCGACCGTGGACCCGACCATGAACGCCACCTACGCTGATACTCTGAAGACGGTGTGCCCCCCGCCGGGCAGCAATGGCGGCGAC
CCGGTGATCAACAACAACCGCGTCACGGACCCGAACGTGCTGAGCAACCAGTACTACAGCAACCTGGTGACCGGGCAGGTGCTCTTCGTGTCGGACCAGCAGCTCATGAACAGCAGCTAC
ACGGCGGCCAAGGTGGCCAACAACTCCGCGGACGCTGCGACATGGATGGGGCAGTTTGCCGCGGCGCTGGTGAAGATGGGGCGCATCCAGGTGCTCACAGGGACCGCCGGTCAGGTCAGG
AAGTACTGCAACGTCGTCAAAAGCTAG

Retrieve as FASTA