Entry information : SiPrx104 (Si024554m)
Entry ID 9448
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx104 (Si024554m)
Name (synonym) SiPrx104 (Si024554m)
Class Class III peroxidase    [Orthogroup: Prx123]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx104
start..stop
S start..stop
SbPrx111 503 0 1..323 1..323
SiPrx99 499 3.99e-180 1..323 1..321
SbPrx109 498 1.88e-179 1..323 1..323
ZmPrx129 466 5.16e-167 1..323 1..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9448' 'join(3350463..3350681,3350820..3351572)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3350463..3350681 217 N° 2 3350820..3351572 751  
join(3350463..3350681,3350820..3351572)


exon

Literature and cross-references SiPrx104 (Si024554m)
DNA ref. Phytozome 12:   scaffold_3 (3350463..3351572)
Protein sequence: SiPrx104 (Si024554m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (297)
PWM (Da):   %s   33715.78 (31136.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.63 (7.68) Peptide Signal:   %s   cut: 27 range:27-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAISACQALLLMALAAAALMMSTASGTLQYNFYSSSCPKAEEAVRNATVKIISNNPTMGAAIVRLFFHDCFVKGCDASILLDQSSSNPQPEKLAIPLRGYDAVNTIKAAVEAVCPGVVSC
ADILAFAARDSAMVSGGFTFPMLGGRRDGLASDLRDIFGSIPAPNMQVQQLVGSFSAKGLSAGDLVALSGAHSFGITHCSFVTPRLYPAVDPTLNATYAAALRKVCPQSSGGGTVLNNNN
ITDPNVLSNQYYKNLGTREVLFKSDQTLTSDAATAKMVQDNADNPVAWMARFAGAMVRMGGIEVLTGNQGEIRKVCGATNSGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCTCAGCATGCCAGGCCTTGCTGCTCATGGCGTTGGCCGCCGCTGCGCTGATGATGAGCACGGCGTCCGGGACATTGCAGTACAACTTCTACAGCTCGTCGTGCCCCAAAGCC
GAGGAGGCGGTGCGCAACGCCACCGTGAAGATCATCTCCAACAACCCCACCATGGGCGCCGCCATCGTGCGCCTCTTCTTCCACGACTGCTTTGTCAAG
AGGTGATTATTNNNNNNNNNN
NNNNNNNNNNNNNNGATCATCTTTATGCCACAGCCATACTATTGTATTTCCTGTCTTATGATCGATCGGTGTCGTTTCAAGTTCAAATATACAATTAAACAACTTCATGTGATTTCCAGG
GTTGCGACGCTTCCATTCTGCTGGACCAGTCGAGCAGCAACCCGCAGCCGGAGAAGCTGGCCATCCCGCTGCGCGGCTACGACGCCGTGAACACCATCAAAGCTGCCGTGGAGGCCGTCT
GCCCCGGCGTGGTCTCCTGCGCCGACATCCTAGCCTTCGCGGCGCGCGACTCCGCCATGGTCTCCGGCGGCTTCACCTTCCCCATGCTGGGCGGCCGCCGCGACGGGCTCGCCTCCGACC
TGCGCGACATCTTCGGGAGCATCCCGGCCCCGAACATGCAGGTCCAGCAGCTCGTCGGCAGCTTCTCCGCCAAGGGCCTGAGCGCCGGCGACCTGGTGGCGCTCTCCGGCGCGCACTCCT
TCGGCATCACCCACTGCTCCTTCGTCACTCCCCGGCTGTACCCCGCCGTCGACCCGACCCTGAACGCCACCTACGCCGCCGCGCTGAGGAAGGTGTGCCCGCAGAGCAGCGGCGGCGGCA
CGGTGCTCAACAACAACAACATCACGGACCCCAACGTGCTGAGCAACCAGTACTACAAGAACCTGGGCACCAGGGAGGTGCTCTTCAAGTCGGACCAGACGCTGACGAGCGACGCCGCCA
CGGCGAAAATGGTGCAGGACAACGCCGACAACCCGGTCGCGTGGATGGCGAGGTTCGCCGGAGCGATGGTGAGGATGGGCGGCATCGAGGTGCTCACCGGGAACCAGGGTGAGATCAGGA
AGGTGTGCGGCGCCACCAACAGTGGCAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCTCAGCATGCCAGGCCTTGCTGCTCATGGCGTTGGCCGCCGCTGCGCTGATGATGAGCACGGCGTCCGGGACATTGCAGTACAACTTCTACAGCTCGTCGTGCCCCAAAGCC
GAGGAGGCGGTGCGCAACGCCACCGTGAAGATCATCTCCAACAACCCCACCATGGGCGCCGCCATCGTGCGCCTCTTCTTCCACGACTGCTTTGTCAAG
GGTTGCGACGCTTCCATTCTG
CTGGACCAGTCGAGCAGCAACCCGCAGCCGGAGAAGCTGGCCATCCCGCTGCGCGGCTACGACGCCGTGAACACCATCAAAGCTGCCGTGGAGGCCGTCTGCCCCGGCGTGGTCTCCTGC
GCCGACATCCTAGCCTTCGCGGCGCGCGACTCCGCCATGGTCTCCGGCGGCTTCACCTTCCCCATGCTGGGCGGCCGCCGCGACGGGCTCGCCTCCGACCTGCGCGACATCTTCGGGAGC
ATCCCGGCCCCGAACATGCAGGTCCAGCAGCTCGTCGGCAGCTTCTCCGCCAAGGGCCTGAGCGCCGGCGACCTGGTGGCGCTCTCCGGCGCGCACTCCTTCGGCATCACCCACTGCTCC
TTCGTCACTCCCCGGCTGTACCCCGCCGTCGACCCGACCCTGAACGCCACCTACGCCGCCGCGCTGAGGAAGGTGTGCCCGCAGAGCAGCGGCGGCGGCACGGTGCTCAACAACAACAAC
ATCACGGACCCCAACGTGCTGAGCAACCAGTACTACAAGAACCTGGGCACCAGGGAGGTGCTCTTCAAGTCGGACCAGACGCTGACGAGCGACGCCGCCACGGCGAAAATGGTGCAGGAC
AACGCCGACAACCCGGTCGCGTGGATGGCGAGGTTCGCCGGAGCGATGGTGAGGATGGGCGGCATCGAGGTGCTCACCGGGAACCAGGGTGAGATCAGGAAGGTGTGCGGCGCCACCAAC
AGTGGCAGCTAA

Retrieve as FASTA