Entry information : SiPrx106 (Si025059m)
Entry ID 9450
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-08 (Christophe Dunand)
Peroxidase information: SiPrx106 (Si025059m)
Name (synonym) SiPrx106 (Si025059m)
Class Class III peroxidase    [Orthogroup: Prx079]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx106
start..stop
S start..stop
SiPrx102 604 0 2..322 4..325
SbPrx110 551 0 2..324 6..332
ZmPrx128 525 0 3..324 9..336
OsPrx68 436 7e-155 20..324 29..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3326617..3326838 222 N° 2 3325590..3326345 756  
complement(join(3325590..3326345,3326617..3326838))


exon

Literature and cross-references SiPrx106 (Si025059m)
DNA ref. Phytozome 12:   scaffold_3 (3326838..3325590)
Protein sequence: SiPrx106 (Si025059m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (301)
PWM (Da):   %s   34306.13 (31788.8)  
PI (pH):   %s   8.13 (7.97) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPTCKTMLLMAFVAAALIPASLAQSPLQNNFYGSSCPQAEVTVRNVTEGIIRNDPTMGAAFMRLFFHDCFVRGCDASILLDPTANNTQVEKKAIALRGYDAVNKIKAAVESVCPGVVSCADILAFAARDSAVVSGGFASFAMPSGRRDGTVSNFIEVLQNIPSPTFRLQELIKNFAAKGLSIDDLVTLSAAHSFGQAHCSFVNGRLYPTVDPTMNATYAGALKTVCPPPGSNGGDPVINNNRVTDPNVLSKQYYSNLVTGQVLFVSDQQLMNSSYTAAKVANNSADAATWMGQFAAALVKMGGIQVLTGTAGQVRKYCNVTNGY

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACACCAACATGCAAGACCATGCTGCTCATGGCGTTCGTGGCTGCTGCCCTGATCCCGGCGTCGCTGGCGCAGTCACCGCTGCAGAACAACTTCTACGGCTCGTCGTGCCCGCAG
GCTGAGGTCACGGTGCGCAACGTCACCGAGGGGATCATCAGGAACGATCCCACCATGGGCGCCGCCTTCATGCGCCTCTTCTTCCACGACTGCTTTGTCAGG
GTAATCCATCTTCTTATT
ACAACATCCAATGTTTTCCTTTTTGATGTTTTATGAATTATGATATGTACAGTCAAATCTTGAGATACAAAAAAATGAGTTCAATGTTACTAGTACCATTGTAAAATTTTGCTGAATTCT
ACTTAAAGGAAGTTATCGAAACTGGATGTCAAAATTAAATATCTTACTTAGTAGCAACCAGCAAATATTAGGAAAAAGTGGGTAAAGTTGAAAAATCAAAAGCACATGTGAACAAGATCG
ATGGGTTTGTCAGGGCTGCGACGCTTCCATTCTGCTCGACCCGACCGCCAACAACACGCAGGTGGAGAAGAAGGCGATCGCGCTGCGCGGCTACGACGCCGTGAACAAGATCAAGGCCGC
CGTGGAGTCCGTCTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTCGCCTTCGCGGCGCGGGACTCGGCCGTCGTCTCCGGCGGCTTCGCCAGCTTCGCCATGCCCTCGGGCCGCCGCGA
CGGAACCGTCTCCAACTTCATCGAGGTGCTCCAGAACATCCCATCCCCGACCTTCAGGCTCCAGGAGCTCATCAAGAACTTCGCCGCCAAAGGCTTGAGCATCGACGACCTCGTCACGCT
CTCCGCTGCGCACTCCTTCGGGCAGGCGCACTGCTCCTTCGTCAACGGCCGACTGTACCCGACCGTGGACCCGACCATGAACGCCACCTACGCTGGTGCTCTGAAGACGGTGTGCCCCCC
GCCGGGCAGCAATGGCGGCGACCCGGTGATCAACAACAACCGCGTCACGGACCCGAACGTGCTGAGCAAACAGTACTACAGCAACCTGGTGACCGGGCAGGTGCTCTTCGTGTCGGACCA
GCAGCTCATGAACAGCAGCTACACCGCGGCCAAGGTGGCCAACAACTCCGCGGACGCTGCGACATGGATGGGGCAGTTCGCGGCGGCGCTGGTGAAGATGGGCGGCATACAGGTGCTCAC
CGGGACTGCCGGCCAGGTCAGGAAGTACTGTAACGTCACCAATGGCTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACACCAACATGCAAGACCATGCTGCTCATGGCGTTCGTGGCTGCTGCCCTGATCCCGGCGTCGCTGGCGCAGTCACCGCTGCAGAACAACTTCTACGGCTCGTCGTGCCCGCAG
GCTGAGGTCACGGTGCGCAACGTCACCGAGGGGATCATCAGGAACGATCCCACCATGGGCGCCGCCTTCATGCGCCTCTTCTTCCACGACTGCTTTGTCAGG
GGCTGCGACGCTTCCATT
CTGCTCGACCCGACCGCCAACAACACGCAGGTGGAGAAGAAGGCGATCGCGCTGCGCGGCTACGACGCCGTGAACAAGATCAAGGCCGCCGTGGAGTCCGTCTGCCCCGGCGTGGTCTCC
TGCGCCGACATCCTCGCCTTCGCGGCGCGGGACTCGGCCGTCGTCTCCGGCGGCTTCGCCAGCTTCGCCATGCCCTCGGGCCGCCGCGACGGAACCGTCTCCAACTTCATCGAGGTGCTC
CAGAACATCCCATCCCCGACCTTCAGGCTCCAGGAGCTCATCAAGAACTTCGCCGCCAAAGGCTTGAGCATCGACGACCTCGTCACGCTCTCCGCTGCGCACTCCTTCGGGCAGGCGCAC
TGCTCCTTCGTCAACGGCCGACTGTACCCGACCGTGGACCCGACCATGAACGCCACCTACGCTGGTGCTCTGAAGACGGTGTGCCCCCCGCCGGGCAGCAATGGCGGCGACCCGGTGATC
AACAACAACCGCGTCACGGACCCGAACGTGCTGAGCAAACAGTACTACAGCAACCTGGTGACCGGGCAGGTGCTCTTCGTGTCGGACCAGCAGCTCATGAACAGCAGCTACACCGCGGCC
AAGGTGGCCAACAACTCCGCGGACGCTGCGACATGGATGGGGCAGTTCGCGGCGGCGCTGGTGAAGATGGGCGGCATACAGGTGCTCACCGGGACTGCCGGCCAGGTCAGGAAGTACTGT
AACGTCACCAATGGCTAC

Retrieve as FASTA