Entry information : SiPrx109 (Si025258m)
Entry ID 9453
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx109 (Si025258m)
Name (synonym) SiPrx109 (Si025258m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx109
start..stop
S start..stop
SbPrx117 83 2e-20 6..82 7..94
SbPrx117 45 0.000001 88..119 209..240
ZmPrx33 69 0.000000000000003 1..82 1..93
ZmPrx33 52 0.000000003 88..119 208..239
BrPrx29-1Aa_other 59 0.00000000001 43..81 48..86
TsPrx29 59 0.00000000001 5..81 3..88
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5248269..5248394 126 N° 2 5248135..5248236 102 N° 3 5247917..5248054 138  
complement(join(5247917..5248054,5248135..5248236,5248269..5248394))


exon

Literature and cross-references SiPrx109 (Si025258m)
DNA ref. Phytozome 12:   scaffold_3 (5248394..5247917)
Protein sequence: SiPrx109 (Si025258m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   121
PWM (Da):   %s   12834.55  
PI (pH):   %s   7.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADTPGEKLGALARVRAYVLVLVVALRVCTATGDAYGGGGLSLERVVKESLSPVFAVDPTSPAALLSLLFHDCQVHVWDRSFHTCINVGGHTLGGSHCINVNTGRERRDEGYEATLHLKEN*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Only short PS).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGACACTCCTGGTGAAAAGCTCGGTGCTCTTGCTCGTGTTCGTGCATACGTACTCGTGCTCGTGGTAGCGCTGCGTGTGTGCACGGCGACAGGTGATGCCTACGGCGGCGGTGGC
CTCTCC
GTCGACCATTACGACACGAGCCCTGCCCGCAGTTGGAACGCGTCGTCAAGGAGTCCCTCTCGCCGGTCTTCGCTGTGGACCCCACCTCGCCAGCCGCCCTCCTCAGCCTTCTCT
TCCACGACTGCCAAGTCCAT
GTACGTGCGCCGCCTTGGTCGATGATCTATATATATGCAAATTTTGTACAAACGTTTGAACACGAATTATTTTTCGCAAGGTGTGGGATCGATCATTTCA
TACATGCATTAATGTAGGAGGTCACACGCTGGGGGGCAGCCACTGCATAAACGTGAACACTGGCCGAGAGCGCCGCGACGAGGGCTACGAAGCCACGCTGCACCTGAAGGAAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGACACTCCTGGTGAAAAGCTCGGTGCTCTTGCTCGTGTTCGTGCATACGTACTCGTGCTCGTGGTAGCGCTGCGTGTGTGCACGGCGACAGGTGATGCCTACGGCGGCGGTGGC
CTCTCC
TTGGAACGCGTCGTCAAGGAGTCCCTCTCGCCGGTCTTCGCTGTGGACCCCACCTCGCCAGCCGCCCTCCTCAGCCTTCTCTTCCACGACTGCCAAGTCCATGTGTGGGATCGA
TCATTTCATACATGCATTAATGTAGGAGGTCACACGCTGGGGGGCAGCCACTGCATAAACGTGAACACTGGCCGAGAGCGCCGCGACGAGGGCTACGAAGCCACGCTGCACCTGAAGGAA
AATTAA

Retrieve as FASTA