Entry information : SiPrx110 (Si026601m)
Entry ID 9455
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-12 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: SiPrx110 (Si026601m)
Name (synonym) SiPrx110 (Si026601m)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx110
start..stop
S start..stop
SbPrx88 559 0 3..339 4..341
ZmPrx45 553 0 31..339 33..345
BdiPrx118 498 3e-179 23..339 11..331
OsPrx133 493 3e-177 32..339 27..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13151810..13152238 429 N° 2 13152348..13152938 591  
join(13151810..13152238,13152348..13152938)


exon

Literature and cross-references SiPrx110 (Si026601m)
DNA ref. Phytozome 12:   scaffold_8 (13151810..13152938)
Protein sequence: SiPrx110 (Si026601m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (305)
PWM (Da):   %s   34751.55 (31321.8) Transmb domain:   %s   i13-32o
PI (pH):   %s   6.5 (5.71) Peptide Signal:   %s   cut: 35 range:35-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRCSRSNGTNVTGLGLAMAASWLLLLAGVSDGQLQVGFYSRTCPGAESTVASVVRQSGSADPTILPALLRLQFHDCFVRGCDGSVLIKGGSGSAEVDNSKHQGLRGLEIIEGAKTQLEAQCPGVVSCADIVALAARDAVAFTGGPSFDVPTGRRDGKVSNIRDADALPDVHDGIDALRSKFRANGLDEKDLVLLTAAHTVGTTACFFLQDRLYNTPLxxxxxxxxPTIPPGFLSELKSRCAPGDFNTRLPLDRGSGNVFDTSILRNIRNGFAVIGSDAALYNDTATVDVVDSYSGLLSNFFGPYFRQDFADAMVRMGSIGVVTGGAGEVRKVCSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Undetermined residues due to NNNNN in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGAAGGTGTAGTCGTAGCAATGGTACCAACGTGACAGGCTTGGGCTTGGCCATGGCGGCCTCATGGCTGCTGCTGCTCGCCGGCGTCTCCGACGGCCAGCTCCAGGTGGGGTTC
TACTCCCGGACCTGCCCCGGCGCCGAGTCCACGGTCGCCTCCGTCGTCCGGCAGTCCGGCTCCGCCGACCCAACCATCCTCCCGGCGCTCCTCCGCCTCCAGTTCCACGACTGCTTCGTC
CGCGGCTGCGACGGCTCCGTCCTCATCAAGGGCGGCAGCGGCAGCGCCGAGGTCGACAACAGCAAGCACCAGGGCCTCCGCGGGCTCGAGATCATCGAGGGCGCCAAGACCCAGCTCGAG
GCCCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATTGTCGCCCTCGCCGCCCGCGACGCCGTCGCATTC
GTGCGTACACTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNGGGGAACGTATCTGAACGACGTGCACTCGTCGATGCAGACCGGCGGGCCGTCGTTCGACGTGCCGACGGGGCGTCGCGACGGGAAGGTGTCGAACATCCG
CGACGCCGACGCGCTCCCCGACGTGCACGACGGCATCGACGCGCTGCGCTCCAAGTTCCGCGCCAACGGGCTCGACGAGAAGGACCTCGTCCTCCTCACGGCGGCGCACACGGTGGGCAC
GACGGCGTGCTTCTTCCTGCAGGACCGGCTCTACAACACCCCTCTNNNNNNNNNNNNNNNNNNNNNNNACCCCACGATCCCGCCGGGGTTCCTGTCGGAGCTCAAGTCCCGGTGCGCGCC
GGGGGACTTCAACACGCGGCTGCCGCTGGACCGCGGCAGCGGCAACGTCTTCGACACCTCCATCCTCCGCAACATCCGCAACGGCTTCGCCGTCATCGGCTCCGACGCCGCGCTCTACAA
CGACACGGCCACCGTCGACGTCGTCGACTCCTACTCCGGCCTGCTCAGCAACTTCTTCGGGCCATACTTCCGCCAGGACTTCGCCGACGCCATGGTCCGCATGGGCAGCATCGGCGTCGT
CACCGGCGGCGCCGGCGAGGTCAGGAAGGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGAAGGTGTAGTCGTAGCAATGGTACCAACGTGACAGGCTTGGGCTTGGCCATGGCGGCCTCATGGCTGCTGCTGCTCGCCGGCGTCTCCGACGGCCAGCTCCAGGTGGGGTTC
TACTCCCGGACCTGCCCCGGCGCCGAGTCCACGGTCGCCTCCGTCGTCCGGCAGTCCGGCTCCGCCGACCCAACCATCCTCCCGGCGCTCCTCCGCCTCCAGTTCCACGACTGCTTCGTC
CGCGGCTGCGACGGCTCCGTCCTCATCAAGGGCGGCAGCGGCAGCGCCGAGGTCGACAACAGCAAGCACCAGGGCCTCCGCGGGCTCGAGATCATCGAGGGCGCCAAGACCCAGCTCGAG
GCCCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATTGTCGCCCTCGCCGCCCGCGACGCCGTCGCATTC
ACCGGCGGGCCGTCGTTCGACGTGCCGACGGGGCGTCGCGACGGGAAGGTG
TCGAACATCCGCGACGCCGACGCGCTCCCCGACGTGCACGACGGCATCGACGCGCTGCGCTCCAAGTTCCGCGCCAACGGGCTCGACGAGAAGGACCTCGTCCTCCTCACGGCGGCGCAC
ACGGTGGGCACGACGGCGTGCTTCTTCCTGCAGGACCGGCTCTACAACACCCCTCTNNNNNNNNNNNNNNNNNNNNNNNACCCCACGATCCCGCCGGGGTTCCTGTCGGAGCTCAAGTCC
CGGTGCGCGCCGGGGGACTTCAACACGCGGCTGCCGCTGGACCGCGGCAGCGGCAACGTCTTCGACACCTCCATCCTCCGCAACATCCGCAACGGCTTCGCCGTCATCGGCTCCGACGCC
GCGCTCTACAACGACACGGCCACCGTCGACGTCGTCGACTCCTACTCCGGCCTGCTCAGCAACTTCTTCGGGCCATACTTCCGCCAGGACTTCGCCGACGCCATGGTCCGCATGGGCAGC
ATCGGCGTCGTCACCGGCGGCGCCGGCGAGGTCAGGAAGGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA