Entry information : SiPrx116 (Si030179m)
Entry ID 9460
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx116 (Si030179m)
Name (synonym) SiPrx116 (Si030179m)
Class Class III peroxidase    [Orthogroup: Prx089]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx116
start..stop
S start..stop
ZmPrx63 448 3e-159 1..333 1..351
SbPrx35 439 6e-155 48..336 116..416
ZmPrx68 432 2e-153 46..333 30..332
SiPrx134 387 4e-135 6..332 8..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46704901..46704996 96 N° 2 46705126..46705275 150 N° 3 46705399..46706163 765  
join(46704901..46704996,46705126..46705275,46705399..46706163)


exon

Literature and cross-references SiPrx116 (Si030179m)
DNA ref. Phytozome 12:   scaffold_2 (46704901..46706163)
Protein sequence: SiPrx116 (Si030179m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (317)
PWM (Da):   %s   35278.63 (33437.6)  
PI (pH):   %s   7.95 (7.69) Peptide Signal:   %s   cut: 20 range:20-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAKLAVLTVLALLGSVSCQSGYGGYGYGDGNPYSSPPPTPSPPAAGLRFGYYDNKCPGAEGVVREAVRGANASIQAGLVQPGCDASVLLKPTDANRQPEMLGIPNLSLRGFEVIDAAKAKLEADCPGVVSCADIVAFAGRDASYFLSGSAISFAMPAGRYDGNVSLASKTLPNLPPPFADVPRLKAMFAAKGLDTVDMVALSGAHSIGSSHCSSFPDRLSNTSDMDRTLAAKLKANCTSPTGSDNLVAQDYKTPDQLDNQYYMNVINRRVLFASDAALLKSNETIRLVYEAAFSPKLWQYKFGQAMVKMGAVEVKTAANGEIRKVCGFINNPYSG*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTAAGCTCGCCGTTCTCACCGTACTCGCGCTGCTCGGCTCCGTGTCGTGCCAATCCGGCTACGGCGGCTACGGCTATGGCGACGGCAACNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTTATTCTTCTCCT
CCTCCCACACCTAGCCCGCCGGCCGCCGGGCTCAGGTTCGGATACTACGACAACAAGTGCCCCGGAGCGGAAGGCGTCGTGAGGGAGGCCGTGCGCGGCGCCAACGCTAGCATCCAAGCA
GGGCTCGTCCAGCCT
GTTCTTCCACGACTGCTTCGTCGAGGTAAGATCACAATCAGTAGTTTCCTGTATTTTGATCAGCAAGTATACTTTATCCAGCTGACAATGTATTTACTCGATCCA
TCGGGACGTGTTCATCAGGGCTGCGACGCCTCCGTTCTGCTGAAGCCGACCGACGCCAACCGGCAGCCGGAGATGCTGGGCATCCCGAACCTGAGCCTGCGCGGCTTCGAGGTCATCGAC
GCGGCGAAGGCAAAGCTCGAGGCGGACTGCCCTGGCGTCGTGTCCTGCGCCGACATCGTCGCCTTCGCCGGCCGCGACGCCAGCTACTTCCTCAGCGGCAGCGCCATCAGCTTCGCCATG
CCCGCGGGCCGCTACGACGGCAACGTGTCCCTCGCCAGCAAGACCCTCCCCAACCTGCCCCCGCCGTTCGCCGACGTCCCGCGCCTCAAGGCCATGTTCGCCGCCAAGGGGCTCGACACC
GTCGACATGGTCGCACTCTCCGGCGCGCACAGCATCGGCAGCTCCCACTGCTCCTCCTTCCCCGACCGCCTCAGCAACACCTCGGACATGGACCGCACGCTCGCCGCCAAGCTCAAGGCC
AACTGCACGTCGCCGACCGGCTCCGACAACTTGGTGGCGCAGGACTACAAGACCCCCGACCAGCTGGACAACCAGTATTACATGAACGTGATCAACCGCAGGGTGCTCTTCGCGTCGGAC
GCCGCGCTCCTCAAGTCGAACGAGACGATCCGACTGGTGTACGAGGCCGCCTTCTCTCCGAAGCTGTGGCAGTACAAGTTCGGGCAGGCCATGGTGAAGATGGGCGCCGTTGAGGTCAAG
ACCGCCGCCAATGGGGAGATCAGGAAGGTGTGCGGCTTCATCAACAACCCATACTCCGGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTAAGCTCGCCGTTCTCACCGTACTCGCGCTGCTCGGCTCCGTGTCGTGCCAATCCGGCTACGGCGGCTACGGCTATGGCGACGGCAACCCTTATTCTTCTCCTCCTCCCACA
CCTAGCCCGCCGGCCGCCGGGCTCAGGTTCGGATACTACGACAACAAGTGCCCCGGAGCGGAAGGCGTCGTGAGGGAGGCCGTGCGCGGCGCCAACGCTAGCATCCAAGCAGGGCTCGTC
CAGCCT
GGCTGCGACGCCTCCGTTCTGCTGAAGCCGACCGACGCCAACCGGCAGCCGGAGATGCTGGGCATCCCGAACCTGAGCCTGCGCGGCTTCGAGGTCATCGACGCGGCGAAGGCA
AAGCTCGAGGCGGACTGCCCTGGCGTCGTGTCCTGCGCCGACATCGTCGCCTTCGCCGGCCGCGACGCCAGCTACTTCCTCAGCGGCAGCGCCATCAGCTTCGCCATGCCCGCGGGCCGC
TACGACGGCAACGTGTCCCTCGCCAGCAAGACCCTCCCCAACCTGCCCCCGCCGTTCGCCGACGTCCCGCGCCTCAAGGCCATGTTCGCCGCCAAGGGGCTCGACACCGTCGACATGGTC
GCACTCTCCGGCGCGCACAGCATCGGCAGCTCCCACTGCTCCTCCTTCCCCGACCGCCTCAGCAACACCTCGGACATGGACCGCACGCTCGCCGCCAAGCTCAAGGCCAACTGCACGTCG
CCGACCGGCTCCGACAACTTGGTGGCGCAGGACTACAAGACCCCCGACCAGCTGGACAACCAGTATTACATGAACGTGATCAACCGCAGGGTGCTCTTCGCGTCGGACGCCGCGCTCCTC
AAGTCGAACGAGACGATCCGACTGGTGTACGAGGCCGCCTTCTCTCCGAAGCTGTGGCAGTACAAGTTCGGGCAGGCCATGGTGAAGATGGGCGCCGTTGAGGTCAAGACCGCCGCCAAT
GGGGAGATCAGGAAGGTGTGCGGCTTCATCAACAACCCATACTCCGGCTAA

Retrieve as FASTA