Entry information : SiPrx118 (Si030295m)
Entry ID 9462
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx118 (Si030295m)
Name (synonym) SiPrx118 (Si030295m)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx118
start..stop
S start..stop
SbPrx33 466 6.95e-166 44..357 42..361
ZmPrx73 457 3.37e-162 1..358 1..365
BdiPrx17 399 1.98e-139 1..357 3..348
OsPrx102 398 4.41e-139 44..356 31..345
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9462' 'complement(join(40927344..40928093,40928182..40928505))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40928182..40928505 322 N° 2 40927344..40928093 748  
complement(join(40927344..40928093,40928182..40928505))


exon

Literature and cross-references SiPrx118 (Si030295m)
DNA ref. Phytozome 12:   scaffold_2 (40928505..40927344)
Protein sequence: SiPrx118 (Si030295m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (329)
PWM (Da):   %s   38890.96 (35879.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.11 (8.95) Peptide Signal:   %s   cut: 29 range:29-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTPPPAISPFLAVSALLLLLFATSVAANGYGGGDGASSGPKGNGEQEGVYHIPAYEKPVKGLDAGFYRKSCPEMEGIVQKAVRKAIRDDYTLAASLIRLFFHDFAVQGVDASVLIDEPK
KSEKYAEASRTLRGFDLIEKIKKEMESKCHATVSCADILTAAARDAATAVGVPYWPLRYGRRDGKNSIAAEADLHVPMGGKSVTDLVRFFESKGLTIFDLVVLSGAHTIGRATCGAVKPG
LCKRKDKPALLDRRYGDFLRRKCGAGGDGEYVELDGETPTAFDNQYYKNLMHGRGVLDTDQKLLLDSRTGDHVRAFANQPSQLFVHQFARSMRKIGEALVRTGNEGEVRRKCSAFNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACGCCACCGCCGGCTATCTCCCCCTTCCTCGCCGTCTCGGCGTTGCTCCTCCTCCTCTTCGCCACCTCGGTGGCGGCGAACGGCTACGGCGGTGGCGACGGCGCTTCGTCGGGG
CCGAAGGGCAACGGCGAGCAGGAAGGTGTTTACCACATCCCGGCGTACGAGAAGCCCGTGAAAGGCCTGGACGCCGGGTTCTACCGCAAGTCGTGCCCGGAAATGGAGGGCATCGTCCAG
AAGGCCGTGAGGAAGGCCATCCGCGACGACTACACACTCGCCGCCAGCCTCATCCGCCTCTTCTTCCACGACTTCGCCGTCCAG
GTACGCACGCCGACCACAGTTCCATCTGTTCTTGAT
CATCTTGCAATGCCATCCATGCATGCTGATTCGCGCTTGCTCGCCGGCGCAGGGGGCGTCGACGCGTCCGTCCTGATCGACGAGCCGAAGAAGAGCGAGAAGTACGCGGAGGCGAGCCGG
ACGCTGCGCGGCTTCGACCTGATCGAGAAGATCAAGAAGGAGATGGAATCCAAGTGCCACGCCACCGTCTCCTGCGCCGACATCCTCACCGCCGCCGCCCGCGACGCCGCCACAGCGGTC
GGGGTCCCCTACTGGCCGCTCCGGTACGGGCGCAGGGACGGCAAGAACTCGATCGCCGCCGAGGCCGACCTCCACGTGCCCATGGGCGGCAAGAGCGTCACCGACCTCGTCAGGTTCTTC
GAGTCCAAAGGCCTCACCATCTTCGACCTCGTCGTCCTCTCCGGCGCCCACACGATCGGGCGTGCCACGTGCGGCGCGGTGAAGCCCGGCCTGTGCAAGCGCAAGGACAAGCCGGCGCTC
CTGGACCGCCGGTACGGCGACTTCCTGCGGCGCAAGTGCGGCGCCGGCGGCGACGGCGAGTACGTGGAGCTCGACGGCGAGACGCCGACGGCGTTCGACAACCAGTACTACAAGAACCTG
ATGCACGGGAGGGGTGTACTGGACACGGACCAGAAGCTGCTCCTGGACTCCCGGACGGGGGACCACGTCAGGGCGTTCGCCAACCAGCCGTCGCAGCTCTTCGTCCACCAGTTCGCGCGG
TCCATGCGCAAGATCGGCGAGGCGCTGGTGCGCACCGGCAACGAGGGCGAGGTCCGCCGCAAGTGCTCCGCCTTCAACTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACGCCACCGCCGGCTATCTCCCCCTTCCTCGCCGTCTCGGCGTTGCTCCTCCTCCTCTTCGCCACCTCGGTGGCGGCGAACGGCTACGGCGGTGGCGACGGCGCTTCGTCGGGG
CCGAAGGGCAACGGCGAGCAGGAAGGTGTTTACCACATCCCGGCGTACGAGAAGCCCGTGAAAGGCCTGGACGCCGGGTTCTACCGCAAGTCGTGCCCGGAAATGGAGGGCATCGTCCAG
AAGGCCGTGAGGAAGGCCATCCGCGACGACTACACACTCGCCGCCAGCCTCATCCGCCTCTTCTTCCACGACTTCGCCGTCCAG
GGCGTCGACGCGTCCGTCCTGATCGACGAGCCGAAG
AAGAGCGAGAAGTACGCGGAGGCGAGCCGGACGCTGCGCGGCTTCGACCTGATCGAGAAGATCAAGAAGGAGATGGAATCCAAGTGCCACGCCACCGTCTCCTGCGCCGACATCCTCACC
GCCGCCGCCCGCGACGCCGCCACAGCGGTCGGGGTCCCCTACTGGCCGCTCCGGTACGGGCGCAGGGACGGCAAGAACTCGATCGCCGCCGAGGCCGACCTCCACGTGCCCATGGGCGGC
AAGAGCGTCACCGACCTCGTCAGGTTCTTCGAGTCCAAAGGCCTCACCATCTTCGACCTCGTCGTCCTCTCCGGCGCCCACACGATCGGGCGTGCCACGTGCGGCGCGGTGAAGCCCGGC
CTGTGCAAGCGCAAGGACAAGCCGGCGCTCCTGGACCGCCGGTACGGCGACTTCCTGCGGCGCAAGTGCGGCGCCGGCGGCGACGGCGAGTACGTGGAGCTCGACGGCGAGACGCCGACG
GCGTTCGACAACCAGTACTACAAGAACCTGATGCACGGGAGGGGTGTACTGGACACGGACCAGAAGCTGCTCCTGGACTCCCGGACGGGGGACCACGTCAGGGCGTTCGCCAACCAGCCG
TCGCAGCTCTTCGTCCACCAGTTCGCGCGGTCCATGCGCAAGATCGGCGAGGCGCTGGTGCGCACCGGCAACGAGGGCGAGGTCCGCCGCAAGTGCTCCGCCTTCAACTACTGA

Retrieve as FASTA