Entry information : SiPrx12 (Si002076m)
Entry ID 9464
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx12 (Si002076m)
Name (synonym) SiPrx12 (Si002076m)
Class Class III peroxidase    [Orthogroup: Prx140]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx12
start..stop
S start..stop
ZmPrx19 632 0 1..344 1..339
ZmPrx83 605 0 1..344 1..348
SbPrx91 600 0 1..344 1..348
OsPrx54 562 0 30..344 29..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16146877..16147332 456 N° 2 16147636..16148214 579  
join(16146877..16147332,16147636..16148214)


exon

Literature and cross-references SiPrx12 (Si002076m)
DNA ref. Phytozome 12:   scaffold_5 (16146877..16148214)
Protein sequence: SiPrx12 (Si002076m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345
PWM (Da):   %s   36928.36 Transmb domain:   %s   i9-31o
PI (pH):   %s   7.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRQWSNGGVAVAAAVLAVLSVLCSAHPVPGGHGGGGFPLQPHFYDHSCPQMQAIVGAIVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSGRFVTEKRSNPNKDSLRGYEVIDEIKAAVEHACPHVVSCADIVAVAARDSVVLTGGPGWEVPLGRRDSLTASLSGSNNLIPAPNDSLPTIIGKFANQGLDVVDLVALSGGHTIGDSRCVSFRQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDPASQFRFDNQYYHNILAMNGLLSSDEILLTQGRETMELVHRFAANQGLFFEQFAKSMVKMGNISPLTGHAGEIRMNCRRVNH*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGCGTCAGTGGAGCAACGGTGGCGTCGCGGTGGCGGCAGCGGTGCTCGCCGTGCTGTCCGTGCTCTGCTCGGCTCACCCGGTGCCGGGCGGCCACGGCGGCGGCGGGTTCCCG
CTGCAGCCGCACTTCTACGACCACAGCTGCCCGCAGATGCAGGCGATCGTGGGCGCCATCGTGGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCCCTGCTGCGGATGCACTTC
CACGACTGCTTCGTGCAGGGTTGCGACGCCTCCGTGCTGCTCGACGCCGACGGCAGCGGCCGGTTCGTCACCGAGAAGCGGTCCAACCCGAACAAGGACTCGCTCCGCGGGTACGAGGTC
ATCGACGAGATCAAGGCCGCCGTCGAGCACGCGTGCCCGCACGTCGTCTCCTGCGCTGACATCGTCGCCGTCGCCGCCAGGGACTCCGTCGTCCTG
GTACGTGATATATGCAATTAACAT
ATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNCTTTTATACAAATGAAAAAAAAGTCAACGGCGATATATATATATGGAAGTATCGGATGGAGTATATAACATACACAACAAGCGGTAACTACTGCAGCGTTC
TTGACTGATTTCATTGCTCCGATGATGGTGATGATGCAGACGGGCGGACCCGGCTGGGAGGTGCCGCTGGGGAGGAGGGACTCGCTGACGGCGAGCCTGAGCGGCTCCAACAACCTCATC
CCGGCTCCCAACGACTCGCTCCCGACCATCATCGGCAAGTTCGCCAACCAAGGCCTCGACGTCGTCGACCTCGTCGCCCTCTCCGGTGGCCACACCATCGGCGACTCCCGGTGCGTGAGC
TTCCGGCAGCGGCTGTACGGACAGAACAACAACGGGCAGGTGGACCGGACGCTGAACCCAGCGTACGCGGCGGAGCTGAGGGGGCGGTGCCCGCGGTCAGGCGGCGACCAGAACCTGTTC
GCTCTGGATCCCGCGAGCCAGTTTCGGTTCGACAACCAGTACTACCACAACATCCTCGCCATGAACGGGCTGCTCAGCTCCGACGAGATCCTGCTCACGCAGGGCCGCGAGACCATGGAG
CTCGTCCACCGCTTCGCCGCTAACCAGGGGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTCACAGGTCACGCCGGCGAGATCAGAATGAACTGC
AGGAGGGTCAACCACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGCGTCAGTGGAGCAACGGTGGCGTCGCGGTGGCGGCAGCGGTGCTCGCCGTGCTGTCCGTGCTCTGCTCGGCTCACCCGGTGCCGGGCGGCCACGGCGGCGGCGGGTTCCCG
CTGCAGCCGCACTTCTACGACCACAGCTGCCCGCAGATGCAGGCGATCGTGGGCGCCATCGTGGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCCCTGCTGCGGATGCACTTC
CACGACTGCTTCGTGCAGGGTTGCGACGCCTCCGTGCTGCTCGACGCCGACGGCAGCGGCCGGTTCGTCACCGAGAAGCGGTCCAACCCGAACAAGGACTCGCTCCGCGGGTACGAGGTC
ATCGACGAGATCAAGGCCGCCGTCGAGCACGCGTGCCCGCACGTCGTCTCCTGCGCTGACATCGTCGCCGTCGCCGCCAGGGACTCCGTCGTCCTG
ACGGGCGGACCCGGCTGGGAGGTG
CCGCTGGGGAGGAGGGACTCGCTGACGGCGAGCCTGAGCGGCTCCAACAACCTCATCCCGGCTCCCAACGACTCGCTCCCGACCATCATCGGCAAGTTCGCCAACCAAGGCCTCGACGTC
GTCGACCTCGTCGCCCTCTCCGGTGGCCACACCATCGGCGACTCCCGGTGCGTGAGCTTCCGGCAGCGGCTGTACGGACAGAACAACAACGGGCAGGTGGACCGGACGCTGAACCCAGCG
TACGCGGCGGAGCTGAGGGGGCGGTGCCCGCGGTCAGGCGGCGACCAGAACCTGTTCGCTCTGGATCCCGCGAGCCAGTTTCGGTTCGACAACCAGTACTACCACAACATCCTCGCCATG
AACGGGCTGCTCAGCTCCGACGAGATCCTGCTCACGCAGGGCCGCGAGACCATGGAGCTCGTCCACCGCTTCGCCGCTAACCAGGGGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTC
AAGATGGGCAACATCTCGCCGCTCACAGGTCACGCCGGCGAGATCAGAATGAACTGCAGGAGGGTCAACCACTAA

Retrieve as FASTA