Entry information : SiPrx126 (Si030527m)
Entry ID 9471
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-12 (Qiang Li)
Peroxidase information: SiPrx126 (Si030527m)
Name (synonym) SiPrx126 (Si030527m)
Class Class III peroxidase    [Orthogroup: Prx209]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx126
start..stop
S start..stop
SbPrx34 526 0 1..308 1..325
ZmPrx93 508 0 1..308 1..326
OsPrx4849 426 3.95e-151 3..308 8..335
SiPrx157 415 4.23e-147 30..308 32..330
Gene structure Fichier Exons


exon

Literature and cross-references SiPrx126 (Si030527m)
DNA ref. Phytozome 12:   scaffold_2 (44499026..44500417)
Protein sequence: SiPrx126 (Si030527m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308 (278)
PWM (Da):   %s   31874.09 (28674.3)  
PI (pH):   %s   9.1 (8.05) Peptide Signal:   %s   cut: 31 range:31-308
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSASRSSQRFRHSKLSLFVALATVVAAARAQLSPTFYASSCPAALVTIKTAVRAAVLLDRRTAGSLLRLHFHDCFVQGCDASVLLDDTGNFTGEKGAGPNAGSLRGFGVIDTIKALLEAL
CPRTVSCADILAVAARDSVVALGGPSWTVPLGRRDSTTASLSTANTDLPSPASSLSTLLAAFARKGLSSTDMVALSGAHTMGQAQCQNYRGRIYNDTDINAAFAASxDATSPNAFDNAYY
GNLVAQRGLLHSDQELFNGGSTDALVRSYAASPAQFSSDFAAGMVRMSGIGVLTGSSGQIRRNCRRVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Short PS was missing due to NNNNN in DNA).
DNA
Send to BLAST
CDS
Send to BLAST