Entry information : SiPrx128 (Si030562m)
Entry ID 9473
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx128 (Si030562m)
Name (synonym) SiPrx128 (Si030562m)
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx128
start..stop
S start..stop
SbPrx48 509 0 1..318 1..321
TaPrx01-1B 491 3e-177 1..318 1..316
AvePrx111-1E_H938 491 5e-177 1..318 1..316
AvePrx111-1_H938 490 9e-177 1..318 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48190023..48190226 204 N° 2 48190321..48190512 192 N° 3 48190616..48191176 561  
join(48190023..48190226,48190321..48190512,48190616..48191176)


exon

Literature and cross-references SiPrx128 (Si030562m)
DNA ref. Phytozome 12:   scaffold_2 (48190023..48191176)
Protein sequence: SiPrx128 (Si030562m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (297)
PWM (Da):   %s   33073.17 (31042.1)  
PI (pH):   %s   6.64 (6.65) Peptide Signal:   %s   cut: 22 range:22-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASCLSLLVLLALASSAAAQLSSTFYDTSCPNALSTIKSAVTSAVNNEPRMGASLLRMHFHDCFVDGCDASVLLNDTSTFTGEQGAIPNRNSLRGFTVIDNIKAQVEAVCNRTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTASKANAESDLPGPSFDLANLTQAFANKGLNLTDMVALSGGHTIGQAQCRFFRDHIYNDTNINSTFASSLQANCPRASGSGDSSLAPLDTASPTSFNNDYFSNLLSRKGLLHSDQELFNGGSADGTVRSFASSASAFSSAFAAAMVKMGNISPKTGSQGQIRLTCSKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCCTCTTGCCTTAGCCTGTTGGTGCTGCTGGCGCTGGCCTCGTCGGCGGCGGCGCAGCTGTCGTCGACGTTCTACGACACGTCGTGCCCCAACGCGCTGTCCACCATCAAG
AGCGCCGTCACGTCGGCCGTGAACAACGAGCCGCGCATGGGGGCGTCGCTGCTCAGGATGCACTTCCACGACTGCTTCGTCGAT
GCAAGTCCCTGCCGCGCTTACTCTGTATTTGCTACG
GCAGGAACATGGCTGACAAAATTCAGTGGACATGCTGACCAGATTTGACTACATGCAGGGCTGCGACGCGTCGGTTCTGTTGAATGACACGTCGACCTTCACCGGCGAGCAGGGGGCGAT
CCCAAACAGGAATTCTCTGAGAGGCTTCACCGTCATCGACAACATCAAGGCGCAGGTGGAGGCCGTGTGCAATCGGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGTGACTC
CGTCGTAGCG
GTAAGCAATTATTTGGTTTGGAACTCTGGATGCGGCTACTTGTACATTTACCGGATGGTAGTAGGCTTATTTATTTGGTTTGGAACTCTGGATTCATGCGCAGCTTGGAG
GGCCGTCGTGGACTGTCCTTCTAGGGAGGAGGGACTCCACCACTGCAAGCAAGGCCAATGCAGAGAGCGACCTGCCAGGCCCTTCCTTCGACCTCGCGAATCTCACCCAGGCGTTCGCAA
ACAAGGGCCTCAACCTCACCGACATGGTTGCTCTGTCAGGCGGGCACACGATCGGGCAGGCGCAGTGCCGCTTCTTCCGCGACCACATCTACAACGACACCAACATCAACTCCACCTTCG
CGTCGTCGCTGCAGGCCAACTGCCCCCGGGCGAGCGGCAGCGGCGACAGCTCCCTGGCGCCGCTGGACACGGCGTCGCCCACCAGCTTCAACAACGACTACTTCAGCAACCTGCTGTCGC
GGAAGGGGCTCCTGCACTCCGACCAGGAGCTCTTCAACGGCGGCAGCGCCGACGGCACGGTCCGGAGCTTCGCGTCCAGCGCGTCGGCGTTCAGCAGCGCCTTCGCGGCGGCGATGGTGA
AGATGGGGAACATCAGCCCCAAGACGGGGAGTCAGGGCCAGATCAGGCTCACCTGCTCCAAGGTGAACTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCCTCTTGCCTTAGCCTGTTGGTGCTGCTGGCGCTGGCCTCGTCGGCGGCGGCGCAGCTGTCGTCGACGTTCTACGACACGTCGTGCCCCAACGCGCTGTCCACCATCAAG
AGCGCCGTCACGTCGGCCGTGAACAACGAGCCGCGCATGGGGGCGTCGCTGCTCAGGATGCACTTCCACGACTGCTTCGTCGAT
GGCTGCGACGCGTCGGTTCTGTTGAATGACACGTCG
ACCTTCACCGGCGAGCAGGGGGCGATCCCAAACAGGAATTCTCTGAGAGGCTTCACCGTCATCGACAACATCAAGGCGCAGGTGGAGGCCGTGTGCAATCGGACCGTCTCCTGCGCCGAC
ATCCTCGCCGTCGCCGCCCGTGACTCCGTCGTAGCG
CTTGGAGGGCCGTCGTGGACTGTCCTTCTAGGGAGGAGGGACTCCACCACTGCAAGCAAGGCCAATGCAGAGAGCGACCTGCCA
GGCCCTTCCTTCGACCTCGCGAATCTCACCCAGGCGTTCGCAAACAAGGGCCTCAACCTCACCGACATGGTTGCTCTGTCAGGCGGGCACACGATCGGGCAGGCGCAGTGCCGCTTCTTC
CGCGACCACATCTACAACGACACCAACATCAACTCCACCTTCGCGTCGTCGCTGCAGGCCAACTGCCCCCGGGCGAGCGGCAGCGGCGACAGCTCCCTGGCGCCGCTGGACACGGCGTCG
CCCACCAGCTTCAACAACGACTACTTCAGCAACCTGCTGTCGCGGAAGGGGCTCCTGCACTCCGACCAGGAGCTCTTCAACGGCGGCAGCGCCGACGGCACGGTCCGGAGCTTCGCGTCC
AGCGCGTCGGCGTTCAGCAGCGCCTTCGCGGCGGCGATGGTGAAGATGGGGAACATCAGCCCCAAGACGGGGAGTCAGGGCCAGATCAGGCTCACCTGCTCCAAGGTGAACTCCTGA

Retrieve as FASTA