Entry information : SiPrx129 (Si030593m)
Entry ID 9474
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx129 (Si030593m)
Name (synonym) SiPrx129 (Si030593m)
Class Class III peroxidase    [Orthogroup: Prx120]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx129
start..stop
S start..stop
SiPrx131 504 0 1..312 1..312
PviPrx09 492 3e-177 2..312 19..336
OsPrx114 448 3e-160 1..312 1..311
TaPrx113-1D 437 8e-156 2..312 3..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48182932..48183135 204 N° 2 48183290..48183472 183 N° 3 48183561..48183726 166 N° 4 48183888..48184273 386
join(48182932..48183135,48183290..48183472,48183561..48183726,48183888..48184273 )


exon

Literature and cross-references SiPrx129 (Si030593m)
DNA ref. Phytozome 12:   scaffold_2 (48182932..48184273)
Protein sequence: SiPrx129 (Si030593m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (291)
PWM (Da):   %s   33129.4 (31112.3)  
PI (pH):   %s   5.6 (5.60) Peptide Signal:   %s   cut: 22 range:22-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASFLGLLVLVALASGASAQLSPTFYDTSCPNALSTIRTAVNAAVAQEARMGASLLRLHFHDCFVQGCDASVLLNETSGEQTQAPNFRSLRGFGVIDNIKAQIEALCPQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSTMSFPNEALSDLPPFTDSLQNLITAFRNKNLDATDLVALSGAHTIGQARCTTFRDHITEPNINPTFAASLRANCPATGGDDNLAPLDVTTPNSFDNAYFSNLMSQRGLLHSDQELFNNGSTDNIVRNFASNAAAFSSAFATAMVKMGNLQPLTGTNGQIRRLCWRVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCTTCTTTCCTTGGGTTGTTGGTGCTCGTGGCGTTGGCCTCTGGGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCCAACGCGCTGTCCACCATCAGG
ACCGCCGTGAATGCCGCGGTGGCGCAGGAGGCTCGCATGGGAGCGTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GCAAGTCCCACATATGCATTACCCTTAATCTTTTCT
TGTTCTGTTCTTTAATTTAACAGTCGATCATCCAAATTGAAGTCTTTTTTGTAAGCTAGCAGCAGTAAATGCAAGCAAGGAACTAATTGGGTATTCTAATTTCTAAACCTTACTCCAGGG
CTGCGACGCGTCCGTTCTGCTGAATGAAACGAGCGGGGAGCAGACCCAGGCGCCGAACTTTAGATCGCTGAGGGGCTTCGGCGTCATCGACAACATCAAGGCGCAGATCGAGGCCTTGTG
CCCGCAGACCGTCTCCTGCGCCGACATCCTCACCGTTGCCGCCCGCGACTCCGTCGTAGCG
GTGAGATCATTAGCACGCGATTACTGAACGATCCATGCATGCCCTGATGCTCGTACTCT
GTTGTTGTTGCCTTGTTGGTCTTCCACAGCTCGGGGGGCCATCGTGGACCGTTCCACTCGGAAGAAGGGACTCTACCATGTCGTTCCCGAACGAGGCACTTAGCGACCTCCCACCTTTTA
CAGATAGCCTCCAAAACCTTATAACAGCGTTTAGGAACAAGAACCTCGACGCAACAGACTTGGTTGCCCTCTCAG
GTGCATGCCCTAGAACAGTTCTTCGTGTTCATCTCATCGTTAATC
TGTAGATAATTAAATTTGAATCTTTGATGTCAGTGCCAGCTGCAGGAGCCCAACAGGACACTCCTAGCTTTGTGATTTGTTTCGGAACTGACATCTAGGTCACCGTACCTTTGCAGGCGC
TCACACTATCGGACAGGCGAGGTGCACGACCTTCCGGGACCACATCACCGAGCCCAACATCAACCCCACCTTCGCGGCGTCGCTCAGGGCCAACTGCCCCGCGACAGGCGGCGACGACAA
CCTGGCGCCGCTGGACGTCACGACGCCCAACAGTTTCGACAACGCCTACTTCAGCAACCTGATGTCGCAAAGGGGTCTCCTGCACTCGGACCAGGAGCTCTTCAACAACGGCAGCACCGA
CAACATCGTCAGGAACTTCGCGTCCAACGCAGCGGCGTTCAGCAGCGCCTTCGCCACGGCCATGGTGAAGATGGGCAACCTTCAGCCGCTGACCGGGACCAATGGGCAGATCAGGCGCCT
CTGCTGGAGGGTCAACTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCTTCTTTCCTTGGGTTGTTGGTGCTCGTGGCGTTGGCCTCTGGGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCCAACGCGCTGTCCACCATCAGG
ACCGCCGTGAATGCCGCGGTGGCGCAGGAGGCTCGCATGGGAGCGTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GGCTGCGACGCGTCCGTTCTGCTGAATGAAACGAGC
GGGGAGCAGACCCAGGCGCCGAACTTTAGATCGCTGAGGGGCTTCGGCGTCATCGACAACATCAAGGCGCAGATCGAGGCCTTGTGCCCGCAGACCGTCTCCTGCGCCGACATCCTCACC
GTTGCCGCCCGCGACTCCGTCGTAGCG
CTCGGGGGGCCATCGTGGACCGTTCCACTCGGAAGAAGGGACTCTACCATGTCGTTCCCGAACGAGGCACTTAGCGACCTCCCACCTTTTACA
GATAGCCTCCAAAACCTTATAACAGCGTTTAGGAACAAGAACCTCGACGCAACAGACTTGGTTGCCCTCTCAG
GCGCTCACACTATCGGACAGGCGAGGTGCACGACCTTCCGGGACCAC
ATCACCGAGCCCAACATCAACCCCACCTTCGCGGCGTCGCTCAGGGCCAACTGCCCCGCGACAGGCGGCGACGACAACCTGGCGCCGCTGGACGTCACGACGCCCAACAGTTTCGACAAC
GCCTACTTCAGCAACCTGATGTCGCAAAGGGGTCTCCTGCACTCGGACCAGGAGCTCTTCAACAACGGCAGCACCGACAACATCGTCAGGAACTTCGCGTCCAACGCAGCGGCGTTCAGC
AGCGCCTTCGCCACGGCCATGGTGAAGATGGGCAACCTTCAGCCGCTGACCGGGACCAATGGGCAGATCAGGCGCCTCTGCTGGAGGGTCAACTCGTAA

Retrieve as FASTA