1. Browse the Database
  2. View Redoxidase
Entry information : SiPrx134 (Si030855m)
Entry ID 9478
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-12 (Qiang Li)
Peroxidase information: SiPrx134 (Si030855m)
Name (synonym) SiPrx134 (Si030855m)
Class Class III peroxidase    [Orthogroup: Prx145]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx134
start..stop		 S start..stop
SbPrx[P]38 524 0 51..353 160..458
ZmPrx97 491 4.7e-176 8..352 7..349
SbPrx37 491 1.39e-175 8..352 8..364
ZmPrx30 491 2.58e-175 51..353 86..391
Gene structure Fichier Exons►


exon

Literature and cross-references SiPrx134 (Si030855m)
DNA ref. Phytozome 12:   scaffold_2 (46709479..46707505)
Protein sequence: SiPrx134 (Si030855m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (332)
PWM (Da):   %s   38146.88 (36110.7)  
PI (pH):   %s   6.16 (6.17) Peptide Signal:   %s   cut: 22 range:22-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAVTLPAILTVLALLGSVACQGGYGDGNPAPAPRPDAYPPVRPR
PPPSPKLKIGYYKNKCDHHVDVEAIVRKHVGSFNDGMKAGLIRLFFHDCFTRGCDASILLDPTSDNQQPEKFGIPNFPSMRGYEVIDAAKAELEAKCPGKVSCADIVAFAARDASYFLSGGGINF
DMPAGRYDGNVSLASETLPNLPPPFAGLQQLEKMFADKGLDSFDMVTLSGAHSIGRSHCSSFSRDRLPPSATSDMDPAFAAGLQANCSSANGADNTVVEDHETPDVLDNQYYQNVLDRKV
LFTSDAALTSKDMTNNLVRVYAIFPWLWQQKFEEAMVKMSRIEVKTAATGEIRRTCRAVNSKP*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA ►
Send to BLAST
CDS►
Send to BLAST