Entry information : SiPrx139 (Si031951m)
Entry ID 9480
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-15 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx139 (Si031951m)
Name (synonym) SiPrx139 (Si031951m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx139
start..stop
S start..stop
SbPrx40 107 3.29e-28 3..128 8..135
SbPrx39 99 5.83e-25 17..128 17..115
SbPrx39 41 0.0000855 136..174 207..245
TaPrx100-1D 92 1.65e-22 1..128 23..140
HvPrx75 87 7.53e-22 1..128 1..114
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9480' 'complement(join(46712818..46713009,46713050..46713433))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46713050..46713433 382 N° 2 46712818..46713009 190  
complement(join(46712818..46713009,46713050..46713433))


exon

Literature and cross-references SiPrx139 (Si031951m)
DNA ref. Phytozome 12:   scaffold_2 (46713433..46712818)
Protein sequence: SiPrx139 (Si031951m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   192 (170)
PWM (Da):   %s   20762.7 (18511.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.94 (9.22) Peptide Signal:   %s   cut: 23 range:23-192
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADKHAALITMLALLAPMACQGFTTFPILCSGEWVRPIKKIVPIL
GFLGDFVRPDGSRPTPIPSPRPPSPAPTGLGLSVGYYNSSYSNYSCPNAETIVKKAVEDAIYRDGRGISAGLIHL
FFHDCFVR
HFFPEMAATRRTVTAPRPFSSLATLEASFAAQGLDPADMVTLSGAHHRPRPLRLHLQLLGHEPD

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing; gap in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGATAAGCACGCTGCCCTCATCACCATGCTTGCGCTCCTCGCGCCAATGGCGTGCCAGGGCTTCACCACTTTCCCTATCCTCTGCTCGGGAGAGTGGGTTCGCCCAATAAAGAAA
ATCGTTCCAATCTTAGGGTTTTTGGGTGACTTTGTCCGCCCTGATGGCTCGAGGCCCACCCCTATCCCTTCTCCAAGGCCCCCAAGCCCTGCTCCCACTGGACTAGGGCTTAGTGTCGGC
TACTACAACAGCAGCTACTCGAATTACTCGTGCCCTAACGCGGAAACCATCGTCAAGAAGGCTGTGGAGGACGCCATCTACAGGGACGGGCGTGGCATTAGCGCAGGGCTCATTCATCTC
TTCTTTCACGACTGCTTCGTTCGG
GTATGATTCGTAACTTTCAAAATGATTGCATTGTTCACAGCACATTTCTTTCCCGAAATGGCGGCAACACGACGTACGGTCACTGCTCCCCGGCCG
TTCTCCAGCCTCGCCACGCTCGAGGCCAGCTTCGCCGCCCAGGGGCTCGACCCCGCCGACATGGTCACGCTCTCCGGTGCGCACCATCGGCCGCGCCCGCTGCGTCTTCATCTCCAACTG
CTCGGACATGAACCAGAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGATAAGCACGCTGCCCTCATCACCATGCTTGCGCTCCTCGCGCCAATGGCGTGCCAGGGCTTCACCACTTTCCCTATCCTCTGCTCGGGAGAGTGGGTTCGCCCAATAAAGAAA
ATCGTTCCAATCTTAGGGTTTTTGGGTGACTTTGTCCGCCCTGATGGCTCGAGGCCCACCCCTATCCCTTCTCCAAGGCCCCCAAGCCCTGCTCCCACTGGACTAGGGCTTAGTGTCGGC
TACTACAACAGCAGCTACTCGAATTACTCGTGCCCTAACGCGGAAACCATCGTCAAGAAGGCTGTGGAGGACGCCATCTACAGGGACGGGCGTGGCATTAGCGCAGGGCTCATTCATCTC
TTCTTTCACGACTGCTTCGTTCGG
CATTTCTTTCCCGAAATGGCGGCAACACGACGTACGGTCACTGCTCCCCGGCCGTTCTCCAGCCTCGCCACGCTCGAGGCCAGCTTCGCCGCCCAG
GGGCTCGACCCCGCCGACATGGTCACGCTCTCCGGTGCGCACCATCGGCCGCGCCCGCTGCGTCTTCATCTCCAACTGCTCGGACATGAACCAGAC

Retrieve as FASTA