Entry information : SiPrx142 (Si032796m)
Entry ID 9484
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx142 (Si032796m)
Name (synonym) SiPrx142 (Si032796m)
Class Class III peroxidase    [Orthogroup: Prx199]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx142
start..stop
S start..stop
SbPrx39 447 4e-159 1..320 42..368
HvPrx40 333 4e-114 19..320 55..353
HvPrx64 331 2e-113 19..320 57..356
HvPrx104 323 3e-110 19..320 55..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46717358..46717567 210 N° 2 46716294..46717043 750  
complement(join(46716294..46717043,46717358..46717567))


exon

Literature and cross-references SiPrx142 (Si032796m)
DNA ref. Phytozome 12:   scaffold_2 (46717567..46716294)
Protein sequence: SiPrx142 (Si032796m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321
PWM (Da):   %s   33899.56  
PI (pH):   %s   6.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MICPGNMIPSPKIDPKPSPAPTGAGLRVGYYNSCPDAEGIVRKVVSDAVAKEPGMGAGLIRLFFHDCFVRGCDASVLLVNSSGSSDPSEMFGPPNRDSLRGFGVIDAAKAALEAACPNAVSCADIMAFAARDASFVLSNGRINFAMPGGRHDGRVSLASETTDVLPGPFTDLQTIKNMFASKGLDTKDVVTLSGAHTVGHARCGFISSDRPDMNATLARDLRNKCRSGNNNTAVVQDYKTPHILDSQYYQNVNDNAVLFQSDAALSSGETQPLVDIYAADSSGNRWETEFAAAMVKMGNIEVKTSPGADAEIRKKCSIYN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Extra 5' end is removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTGCCCCGGAAACATGATCCCGAGCCCTAAAATTGATCCGAAGCCGAGTCCTGCCCCCACAGGGGCGGGGCTCAGGGTCGGCTACTACAACTCGTGCCCCGACGCGGAAGGTATT
GTGAGGAAGGTCGTGAGCGACGCCGTCGCCAAAGAACCTGGCATGGGTGCCGGTCTCATTCGGCTCTTCTTCCACGACTGTTTCGTACGG
GTACAAATTATCTCTTTCAACATAGTTACA
AGTTTGTGTGTATACCGTGTTTCGAAAGAAGAATTTTTTTAAGAGAAAGAGTGGGCATTTAAGCATTGATTTACACCATTTATAGCTACAAAACAAATATGGTGTGAAAAGCATTTTGAT
ATGTTTTACACACACTAATAAGTACACCTGTACTTTGATTAATTGCTAGTCAAGATGTGCAAAATTTGGCCTTTTTCCAAACAAAGATTTGCCTTAGAGTTTTAAAAAGTAAGCAGGAGC
AAGTTTGTGACGTTAGGTGCTGTGGCCACGTGCTCATTGCTCAGGGGTGTGATGCTTCCGTTCTACTCGTGAACTCGAGCGGCTCCAGCGACCCGTCAGAGATGTTCGGCCCACCAAACA
GAGACAGCCTACGGGGATTCGGCGTGATCGACGCGGCCAAGGCGGCGCTCGAGGCGGCCTGCCCCAACGCCGTCTCGTGCGCGGACATCATGGCCTTCGCCGCCCGCGACGCGTCCTTCG
TCCTCAGCAACGGCAGGATCAACTTCGCCATGCCCGGCGGCCGCCACGACGGGCGCGTGTCCCTCGCCTCCGAGACCACCGACGTCCTGCCTGGGCCCTTCACCGACCTCCAGACGATCA
AGAACATGTTCGCCTCCAAGGGCCTCGACACCAAGGACGTGGTCACGCTCTCCGGCGCGCACACCGTCGGCCACGCCCGCTGTGGGTTCATCTCCTCCGACCGCCCGGACATGAACGCCA
CCCTCGCCAGAGATCTCAGGAACAAGTGCAGGAGTGGCAACAACAACACTGCTGTGGTGCAGGACTACAAAACCCCTCACATCCTGGACAGCCAGTACTACCAGAACGTGAACGACAATG
CTGTGCTGTTTCAGTCGGACGCCGCGCTGAGCTCGGGTGAAACGCAGCCTCTGGTGGATATCTACGCCGCCGATTCATCAGGGAACAGGTGGGAGACCGAGTTCGCGGCGGCGATGGTGA
AGATGGGCAACATCGAGGTGAAGACCAGCCCCGGCGCGGACGCCGAGATCAGGAAGAAGTGCTCGATTTACAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTGCCCCGGAAACATGATCCCGAGCCCTAAAATTGATCCGAAGCCGAGTCCTGCCCCCACAGGGGCGGGGCTCAGGGTCGGCTACTACAACTCGTGCCCCGACGCGGAAGGTATT
GTGAGGAAGGTCGTGAGCGACGCCGTCGCCAAAGAACCTGGCATGGGTGCCGGTCTCATTCGGCTCTTCTTCCACGACTGTTTCGTACGG
GGGTGTGATGCTTCCGTTCTACTCGTGAAC
TCGAGCGGCTCCAGCGACCCGTCAGAGATGTTCGGCCCACCAAACAGAGACAGCCTACGGGGATTCGGCGTGATCGACGCGGCCAAGGCGGCGCTCGAGGCGGCCTGCCCCAACGCCGTC
TCGTGCGCGGACATCATGGCCTTCGCCGCCCGCGACGCGTCCTTCGTCCTCAGCAACGGCAGGATCAACTTCGCCATGCCCGGCGGCCGCCACGACGGGCGCGTGTCCCTCGCCTCCGAG
ACCACCGACGTCCTGCCTGGGCCCTTCACCGACCTCCAGACGATCAAGAACATGTTCGCCTCCAAGGGCCTCGACACCAAGGACGTGGTCACGCTCTCCGGCGCGCACACCGTCGGCCAC
GCCCGCTGTGGGTTCATCTCCTCCGACCGCCCGGACATGAACGCCACCCTCGCCAGAGATCTCAGGAACAAGTGCAGGAGTGGCAACAACAACACTGCTGTGGTGCAGGACTACAAAACC
CCTCACATCCTGGACAGCCAGTACTACCAGAACGTGAACGACAATGCTGTGCTGTTTCAGTCGGACGCCGCGCTGAGCTCGGGTGAAACGCAGCCTCTGGTGGATATCTACGCCGCCGAT
TCATCAGGGAACAGGTGGGAGACCGAGTTCGCGGCGGCGATGGTGAAGATGGGCAACATCGAGGTGAAGACCAGCCCCGGCGCGGACGCCGAGATCAGGAAGAAGTGCTCGATTTACAAC

Retrieve as FASTA