1. Browse the Database
  2. View Redoxidase
Entry information : SiPrx146 (Si036439m)
Entry ID 9488
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx146 (Si036439m)
Name (synonym) SiPrx146 (Si036439m)
Class Class III peroxidase    [Orthogroup: Prx102]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx146
start..stop		 S start..stop
SbPrx04 555 0 34..345 43..357
ZmPrx92 549 0 19..345 24..355
OsPrx49 504 0 39..345 43..348
TaPrx159-1B 467 8.41e-167 20..345 25..344
Gene structure Fichier Exons►


exon

Literature and cross-references SiPrx146 (Si036439m)
DNA ref. Phytozome 12:   scaffold_9 (12974824..12972292)
Protein sequence: SiPrx146 (Si036439m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (319)
PWM (Da):   %s   37913.74 (35131.0) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.33 (9.18) Peptide Signal:   %s   cut: 27 range:27-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVRVLPLPPVLVLPLLLALVASVHGYGGYGDGKLRVGFYKDSCPDAEAIVREIVAKAVHKDPTANAPLLRLHFHDCFVRGCEGSVLINSTKGNTAEKDAKPNHTLDAFDVIDDIKEALE
KRCPGTVSCADILAIAARDAVSLATKVVAKGEWSKDGNLYEVETGRRDGSVSSAKEAVKNLPDSFDGIRKLIKRFASKNLSLKDLTVLSGAHAIGKSHCPSIAKRLRNFTENRDSDPTLD
RAYADRLRRRCWRPKDKTTELEMVPGSSETFDTAYYGLVTKRRGLFHSDEALLRNDVTKGLVYRYRDSPETTFLRDFGVSMVNMGRVGVLTGSQGEIRKKCAFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST