Entry information : SiPrx150 (Si036480m)
Entry ID 9493
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx150 (Si036480m)
Name (synonym) SiPrx150 (Si036480m)
Class Class III peroxidase    [Orthogroup: Prx072]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx150
start..stop
S start..stop
SiPrx147 558 0 21..340 25..343
SiPrx149 545 0 4..338 6..342
SiPrx152 494 2e-177 20..338 24..336
ZmPrx34 488 4e-175 21..338 26..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34299552..34299773 222 N° 2 34299885..34300076 192 N° 3 34300897..34301062 166 N° 4 34301437..34301876 440
join(34299552..34299773,34299885..34300076,34300897..34301062,34301437..34301876 )


exon

Literature and cross-references SiPrx150 (Si036480m)
DNA ref. Phytozome 12:   scaffold_9 (34299552..34301876)
Protein sequence: SiPrx150 (Si036480m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (313)
PWM (Da):   %s   36493.02 (34004.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.73 (4.64) Peptide Signal:   %s   cut: 28 range:28-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSPRAAVAGVVAAAAVALCLHGAAAQLCEDYYDDTCPDAYDIVKQVLIDAHRSDVRIYASLIRLHFHDCFVLGCDGSILLDNMTGMQTEKEAVPNMGSARGYDVVDAAKAALEDACPGVVSCADILALAAEISVELSGGPKWGVLLGRLDGKTSSISGANNLPAPFETLDMLRRKFRAVGLNSDVDLVALSGAHTFGRVQCLNIADSPADRLYNFSGTNRPDPTLDPAYRAFLIRRCPTKNGNSPVLNDLDPTTPDLFDKNYYTNLEVNRGILTSDQELKSSPQARGTTAPIVDQFARSQDAFFKSFAQSMINMGNIQPITDPSMGEVRCDCKKVNDS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTCTCCTCGTGCAGCCGTTGCCGGCGTGGTAGCGGCGGCGGCGGTGGCGCTGTGCCTCCACGGCGCGGCGGCGCAGCTGTGCGAGGACTACTACGACGACACGTGCCCTGAC
GCCTACGACATCGTGAAGCAGGTGCTCATCGACGCCCACAGGTCGGACGTGCGCATCTACGCCAGCCTCATCCGCCTCCACTTCCACGACTGCTTCGTCCTG
GTAACGAACCTTTCCTTC
CTCTGTCTGCTAGGACGCCATGGCCGTGCCCATGCATTGTTATTTCCTTGGTGATGCCATGGCCGTTTATGTTATATTGTTCATATATAATAGGGCTGCGACGGGTCGATCCTGCTGGAC
AACATGACTGGGATGCAGACGGAGAAGGAGGCGGTGCCCAACATGGGCTCGGCGCGCGGGTACGATGTGGTGGACGCAGCCAAGGCAGCGCTGGAGGACGCCTGCCCCGGCGTCGTCTCG
TGCGCCGACATCCTCGCCCTCGCCGCAGAGATCTCCGTCGAGCTG
GTACGTTTCTCCTAAATAAACATGCAGCAAAACGTACGTGCATCTGGATTGTAAGTTTATATGATGCATGTAGCA
AAACTTTTCATGACGTACGTGCTTGATGGATGGATGCATGCATCATATCTATCACTCCTGTACTCAGTTACTCACCATGCATGCATAAGGGGTAAGCATGCATGCTGGGTTACTTGTTCC
AAGAATGTTACCACAGAGTTCAGTCCCTCCCGCTGACGTAAATCAGAGTGACATCAGTTGCTCTTGCTCCAATCCCTCGATCAGTTACAAATAAGTGTATGCATGGACTTCACGAAACAC
AACTTTTTAAGTACTACCCTTTTTAGTACACCCTATAAATAAGTATCATACTAATACAGGTAACTTTTAATGAAAGTTTAAACCATCCAACTATAGATAACTCAACTCTTCGACGTGTAA
AAAAATTAATATGGAGCGAGTATCTTGGTAATAGAATCTACGACATGAATTAGCTAAGACTGTATGGAGGGCCAATCCGAAAAACAATCCAAGACCTCTTGGTCTTGAATATCAGAAAAC
GATGAACAAACTGGTCTTTGCTTGGGAACAAAATAATATGTATTATCCACATAGGATATCTTCAAAACGAGAAAATCCATCGATCTGAGACAAAGAGAAAGACTTTTTACTTATTCAGTT
AAACCAAGGATTCATTACGGAAAAGATAGAAACAACCATTCCATCAGACATACACATTTTTATTATCTGGCGGGCTTATATAATTTCATTAATGGAAATTGTCTGCTGGCTAGCTGTAAT
TTTTCATTAATGCTCTCCCACGCAGTCTGGAGGCCCAAAGTGGGGTGTTCTGCTGGGGAGGCTGGACGGCAAGACGTCCAGCATCAGCGGCGCAAACAACCTGCCGGCGCCCTTCGAGAC
CCTCGACATGCTTCGGAGAAAGTTCAGGGCCGTCGGCCTTAACAGCGACGTCGACCTCGTCGCCCTGTCAG
GTAGTACAATATTTATTTCTCACTCCACACGATCTTCACTGCATCGGTT
GGGTTTTCCTCGGACTCGACGTATATCAAAATTATATAGTTACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGA
TATACTATATGTGCAAACCAAAATTACTGTTCTGAGAGTTTCTGATGAAGGCCCCTTCTGTTTCTGTCGAACAATATGACAACAGGGGCCCACACGTTTGGCAGGGTGCAGTGCCTAAAC
ATCGCCGACTCCCCGGCCGACCGGCTCTACAACTTCAGCGGGACAAACAGGCCTGACCCAACCCTTGACCCGGCTTACCGAGCATTCCTAATCCGGAGGTGCCCGACGAAGAATGGCAAC
AGCCCGGTTCTAAACGACCTCGATCCAACAACACCAGACCTCTTCGACAAGAACTACTACACCAACCTTGAAGTGAACCGTGGGATCCTCACTTCCGACCAGGAGCTCAAGTCCTCGCCC
CAAGCGCGGGGCACCACGGCGCCGATCGTCGACCAGTTTGCGAGGAGCCAGGACGCCTTCTTCAAGAGCTTTGCGCAGTCCATGATCAACATGGGGAACATTCAGCCCATTACTGACCCC
TCCATGGGAGAAGTCCGTTGCGACTGCAAGAAGGTTAACGACAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTCTCCTCGTGCAGCCGTTGCCGGCGTGGTAGCGGCGGCGGCGGTGGCGCTGTGCCTCCACGGCGCGGCGGCGCAGCTGTGCGAGGACTACTACGACGACACGTGCCCTGAC
GCCTACGACATCGTGAAGCAGGTGCTCATCGACGCCCACAGGTCGGACGTGCGCATCTACGCCAGCCTCATCCGCCTCCACTTCCACGACTGCTTCGTCCTG
GGCTGCGACGGGTCGATC
CTGCTGGACAACATGACTGGGATGCAGACGGAGAAGGAGGCGGTGCCCAACATGGGCTCGGCGCGCGGGTACGATGTGGTGGACGCAGCCAAGGCAGCGCTGGAGGACGCCTGCCCCGGC
GTCGTCTCGTGCGCCGACATCCTCGCCCTCGCCGCAGAGATCTCCGTCGAGCTG
TCTGGAGGCCCAAAGTGGGGTGTTCTGCTGGGGAGGCTGGACGGCAAGACGTCCAGCATCAGCGGC
GCAAACAACCTGCCGGCGCCCTTCGAGACCCTCGACATGCTTCGGAGAAAGTTCAGGGCCGTCGGCCTTAACAGCGACGTCGACCTCGTCGCCCTGTCAG
GGGCCCACACGTTTGGCAGG
GTGCAGTGCCTAAACATCGCCGACTCCCCGGCCGACCGGCTCTACAACTTCAGCGGGACAAACAGGCCTGACCCAACCCTTGACCCGGCTTACCGAGCATTCCTAATCCGGAGGTGCCCG
ACGAAGAATGGCAACAGCCCGGTTCTAAACGACCTCGATCCAACAACACCAGACCTCTTCGACAAGAACTACTACACCAACCTTGAAGTGAACCGTGGGATCCTCACTTCCGACCAGGAG
CTCAAGTCCTCGCCCCAAGCGCGGGGCACCACGGCGCCGATCGTCGACCAGTTTGCGAGGAGCCAGGACGCCTTCTTCAAGAGCTTTGCGCAGTCCATGATCAACATGGGGAACATTCAG
CCCATTACTGACCCCTCCATGGGAGAAGTCCGTTGCGACTGCAAGAAGGTTAACGACAGT

Retrieve as FASTA