Entry information : SiPrx157 (Si036577m)
Entry ID 9500
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx157 (Si036577m)
Name (synonym) SiPrx157 (Si036577m)
Class Class III peroxidase    [Orthogroup: Prx122]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx157
start..stop
S start..stop
SbPrx14 536 0 36..330 49..344
ZmPrx55 530 0 1..330 10..342
ZmPrx41 531 0 1..330 10..349
OsPrx4849 481 5e-173 16..330 1..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 41547478..41547909 432 N° 2 41547206..41547371 166 N° 3 41545908..41546299 392  
complement(join(41545908..41546299,41547206..41547371,41547478..41547909))


exon

Literature and cross-references SiPrx157 (Si036577m)
DNA ref. Phytozome 12:   scaffold_9 (41547909..41545908)
Protein sequence: SiPrx157 (Si036577m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (299)
PWM (Da):   %s   34022.85 (30864.1) Transmb domain:   %s   i13-35o39-61i
PI (pH):   %s   5.3 (4.60) Peptide Signal:   %s   cut: 32 range:32-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPAASRTHHHRSLALVVLALVAAATATVAGAQLSSEDYYDASCPAALLTIRSAVAAAVLLDRRMGASLLRLHFHDCFVQGCDASVLLDDAGGFTGEKGAGPNAGSLRGFDVIDNAKMLLELLCPQTVSCADILAVAARDAVEQLGGPSWTVPLGRRDATTASASLANSDLPGPTSNLNGLLNAFSNKGLSTTDMVALSGAHTVGRAQCRNFRARIYNDTDIDATFAASLRASCPAQAGSSSDGALEPLDGTSPDAFDNDYFGNLLSQRGLLHSDQALFGGGATDGLVRAYASDAGRWGSDFAAAMVRMASIGPLTGTDGEIRVNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTGCAGCTTCCCGCACGCACCACCACCGCTCGCTGGCCTTGGTCGTCCTCGCGCTGGTGGCGGCCGCAACGGCCACGGTGGCCGGCGCGCAGCTGTCGTCGGAGGACTACTAC
GACGCCTCGTGCCCCGCCGCCCTCCTCACCATCCGGTCCGCCGTGGCGGCGGCGGTGCTGCTCGACCGCCGCATGGGGGCCTCCCTCCTCCGGCTCCACTTCCACGACTGCTTCGTGCAG
GGCTGCGACGCGTCGGTGCTGCTGGACGACGCGGGGGGCTTCACCGGCGAGAAGGGGGCGGGGCCGAACGCGGGGTCGCTGCGGGGATTCGACGTCATCGACAACGCCAAGATGCTGCTC
GAGCTCCTGTGCCCGCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACGCCGTCGAACAA
GTAATAAGCCAGCTTCGATTGTGAATCTCTCTGGAAAACTGAACTGAA
AGAGAAAGAGAAGGGCTGATTAATTTTGATCGCACGACGTCTCCTGTTGTTGGTGCAGCTGGGAGGCCCATCCTGGACGGTTCCCCTGGGCAGGAGGGACGCGACGACGGCGAGCGCGTC
CCTGGCCAACAGCGACCTCCCCGGACCCACCTCCAACCTCAACGGCCTCCTCAACGCTTTCTCCAACAAGGGACTCAGCACCACCGACATGGTCGCCCTGTCAG
GTAGTACGCTTGCACA
TTGCAATCCGATCCATGCATCTCCTTTTTCCTGCATCATGCAACGCATGTGTAGACAGATTCGCAGCCGGCAGGCTAAGGATGGCGGATGGCACGTCCCATCTTAGATCTTGCTCACACT
GAATTCGTCATGGAAGCCGATCATCATCTACAGGCTATCTAGCTAGAGCACATGGCATGTCCCGGTAAAAAATAGACCAAAAATCACAGGCGATTGAAATCGACGCGGCAGCGAACGAAC
TAGATCTTTGCAGAATTGCACCCATTCCGGCCGGTAGTGCGACCAAATTAATGAAAGCACTCCTGTCGTCAGGTAGCTATCGAGATCCACAGTAAGCTATAGCTAGCATACTACTCAACT
GCTGTAGATCTCATGATCTTTAGCCGCATACATACGTGATACGTGCACTCGCATTCCAGTGTTTGTTTCGTTCTGTTTTCTGTCATCGGTAGGCGGCCCCTCTTGTGTCTTCTTTCCGAC
TTCGATCGTGAGTCTGCACATCGTACCAACGAAAAAAAAATATGCATGACACATTACTATGACACATGCATGATGCATCATTGTTCGTCTGCATGCGCCGATCAATTCAACATGGTGATC
GATGACATGACATGCTGTTTGCAGTCTCTGTTCCACTCACCACCACCTTTTTGCTCGCAACAACATTTGGACGAGCCCGCGTCACCTACCTGTCTACGAGCTCTCTAGCCACGTCGTAGT
ACGTGCACGATCATCTCCATCCATCACGCGACCGCCCAACCACCTGCTCCTCGCTTCCACTTCTTCCACCGCGCAATCATGCACTTGCATGCGACACAGCAAGCAAGGTTTCCCATCTGC
CCATCTCCATGATTGCCTCGCCTCGCCTCACGACTTGCTTACCACTGCAGGGGCCCACACCGTCGGGCGGGCGCAGTGCCGGAACTTCCGGGCCCGGATCTACAACGACACCGACATCGA
CGCCACCTTCGCGGCGTCGCTGCGGGCGAGCTGCCCGGCGCAGGCGGGCTCCTCCAGCGACGGCGCGCTGGAGCCGCTGGACGGGACGTCGCCGGACGCCTTCGACAACGACTACTTCGG
GAACCTGCTCTCCCAGCGCGGGCTGCTGCACTCCGACCAGGCGCTCTTCGGCGGCGGCGCCACGGACGGCCTCGTCAGGGCCTACGCGTCCGACGCCGGCCGATGGGGGAGCGACTTCGC
GGCGGCGATGGTCAGGATGGCCAGCATCGGCCCGCTCACCGGCACGGACGGCGAGATCAGGGTCAACTGCCGGAGGGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTGCAGCTTCCCGCACGCACCACCACCGCTCGCTGGCCTTGGTCGTCCTCGCGCTGGTGGCGGCCGCAACGGCCACGGTGGCCGGCGCGCAGCTGTCGTCGGAGGACTACTAC
GACGCCTCGTGCCCCGCCGCCCTCCTCACCATCCGGTCCGCCGTGGCGGCGGCGGTGCTGCTCGACCGCCGCATGGGGGCCTCCCTCCTCCGGCTCCACTTCCACGACTGCTTCGTGCAG
GGCTGCGACGCGTCGGTGCTGCTGGACGACGCGGGGGGCTTCACCGGCGAGAAGGGGGCGGGGCCGAACGCGGGGTCGCTGCGGGGATTCGACGTCATCGACAACGCCAAGATGCTGCTC
GAGCTCCTGTGCCCGCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACGCCGTCGAACAA
CTGGGAGGCCCATCCTGGACGGTTCCCCTGGGCAGGAGGGACGCGACG
ACGGCGAGCGCGTCCCTGGCCAACAGCGACCTCCCCGGACCCACCTCCAACCTCAACGGCCTCCTCAACGCTTTCTCCAACAAGGGACTCAGCACCACCGACATGGTCGCCCTGTCAG
GG
GCCCACACCGTCGGGCGGGCGCAGTGCCGGAACTTCCGGGCCCGGATCTACAACGACACCGACATCGACGCCACCTTCGCGGCGTCGCTGCGGGCGAGCTGCCCGGCGCAGGCGGGCTCC
TCCAGCGACGGCGCGCTGGAGCCGCTGGACGGGACGTCGCCGGACGCCTTCGACAACGACTACTTCGGGAACCTGCTCTCCCAGCGCGGGCTGCTGCACTCCGACCAGGCGCTCTTCGGC
GGCGGCGCCACGGACGGCCTCGTCAGGGCCTACGCGTCCGACGCCGGCCGATGGGGGAGCGACTTCGCGGCGGCGATGGTCAGGATGGCCAGCATCGGCCCGCTCACCGGCACGGACGGC
GAGATCAGGGTCAACTGCCGGAGGGTGAAT

Retrieve as FASTA