Entry information : SiPrx16 (Si002134m)
Entry ID 9503
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx16 (Si002134m)
Name (synonym) SiPrx16 (Si002134m)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx16
start..stop
S start..stop
SbPrx65 619 0 24..336 30..342
ZmPrx61 613 0 24..336 22..335
SofPrx02 613 0 29..336 32..339
OsPrx17 600 0 5..337 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24656174..24656413 240 N° 2 24656524..24656715 192 N° 3 24657698..24657863 166 N° 4 24658343..24658755 413
join(24656174..24656413,24656524..24656715,24657698..24657863,24658343..24658755 )


exon

Literature and cross-references SiPrx16 (Si002134m)
DNA ref. Phytozome 12:   scaffold_5 (24656174..24658755)
Protein sequence: SiPrx16 (Si002134m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   36251.42  
PI (pH):   %s   8.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGAMAALALVPLAVAVLFSSLPSSAASPVQWGKLDPHFYDHSCPQAQQIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASLLLDSSGSIVSEKRSNPNRDSARGFEVIDEIKAALEAACPGTVSCADILALSARDSTVMTGGPGWIVPLGRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYNQTGNGLPDFTLDASYAAALRPRCPRSGGDQNLFFLDPVTPFKFDNQYYKNILANRGLLASDEVLLTGSSATADLVKLYAANQDIFFQHFAQSMVKMGNISPLTGADGEIRKHCRRVNHK*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGTGCAATGGCGGCCTTGGCCTTGGTGCCTCTCGCCGTTGCGGTTCTCTTCTCCTCCCTGCCGTCGTCGGCGGCGTCCCCTGTGCAGTGGGGGAAGCTGGACCCCCACTTCTAC
GACCACTCGTGCCCGCAGGCGCAGCAGATCGTGGCGTCCATCGTGGGGAAGGCGCACTACCAGGACCCCCGCATGGCCGCCTCCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAG
GTACACGAGATCGTGCCGCTGCGCGCGTCGCTTGTCTTGTCTGATGAACATTCCTTCTGCCGGCCGGTGCTTTATCGAGCTTGACGATGAGTTGACGATGTATCCATCAGGGCTGCGACG
CGTCGCTCCTGCTTGACAGCAGCGGGTCGATCGTGAGCGAGAAGCGGTCCAACCCCAACCGGGACTCGGCCAGGGGCTTCGAGGTCATCGACGAGATCAAGGCCGCCCTCGAGGCTGCCT
GCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCAGCGCCCGCGACTCCACCGTCATG
GTACGTCACGTGCAGAGCGCGGCACCTCAGCAATCTTTCAACCATTTCTCGCGCATCA
GCTCCTTTGTGTTTCTTTCTCTGTTGCGCTTGCGCTATGCATATTCCCAATTTCTTATGTGTTTATCATGGCGATCCAATCAGGAAAATATATGCACGCAGCACGCATCGCATAAGATGC
CTAGAGATTGGCATGCCTAGATGACAAGACCTTAAACGCTTTATTAAACTCTATTATGTGTGAAACTAAAGGACATGCCTTTTTTTGTGGAGTATTAATGCACAATTTATTCCAAAGACG
TTTTGAGAAAACAAAAAAAATGAACTTAAAGATTGGCATGTCAAGCGAAAAGAGTTGTTAATTACCTGCAGCTGTCCACATAGCTACATGAACAAATTAGTTACATGCGTGCAATAATAC
TCTATTATTGTATACCCCTATCTAGTTTTTCTCCCATAGTTTCATTATTGACCCACTGTAGTAGTGTCGGTGAGCATACACGAGCGAGTGTGATTTCCATGGCCTATGTACCACAAGGCA
CATGCAAAACCCGGCCGCTCGCTGTTTCTCCGCCGGGCCCCCTGCACAATGATGTGTCCTCTCCAGTCTTCACTCTCACCCTATCCAGGACAGTACAAAATCTACATTGCTGATTCCTTG
TGCCACACCGTAAAGAAGAGACAAAGTTCATGTGGGGGGCACGGCACCGTGCTCGGTAAAGCAGCGCCAAAGTGCATGTAGTTTCAAAGCCTCATGGCATCTCATGTCTGCCATGGGATA
AAGACAGGGTAAACTAAAAGGGCCTCTCTAGCTACCATGCCATCTCTACTTTTTAGACTTGTCAACACTGTAGTATTAGCTCAAATGATACGCGAATTCTTTTTTACTGCCAATTTTAAT
TACATTGCGTCCCCGACTGCTTCACTGAAATCACCATCAAGTTAACTGCTGACATTTCTGATCATTGGCTGCACGAAATTGCAGACCGGTGGGCCCGGGTGGATTGTGCCTCTGGGGCGT
AGGGACTCACGCGGCGCCAGCGTGCAGGGCTCCAACAACGATATCCCGGCACCCAACAACACCCTCCCCACCATCATCACCAAGTTCAAGCTCCAGGGCCTCGACATCGTCGACCTCGTC
GCACTCCTCG
GTATGTACACATCGATCACACGTACACACATGAATGTCTGTGTTGAGTGTGCCAACTGATTGAAAGCTGCTAGCTAGTAGATGATGTGTGGATCAGTGGGATAGATGTTG
TGTGGCAATACTGGTAGCCACCATGCCACCATCTGTGTTGGCGTTGCTTTTTCCGAAGAGAGTACTGTGCCAACTGATTGAAAGCTAGATGAGCTGGCTAGGCAGCGACAACACTTGGCT
GATTGGTCCAAAAAGTCATACCTCGCTGTTGTGGACGGCGTCAGCCAGTACACAGTCCATATGTGCATAGTGTCCGGACAAGTACATTGTTGTGGTTGGATGATTTGACGGCATTGCCAG
ATTTGTTCTTGATGCTAACTGATTGTTACATAACAATATGATCGGTTTGCCGGACTGATTGTTACTACATTGCTGTGTGTAACAATAATAGTACATGACAAGAACTCTTCCTCTGATGAT
GACATACAGGTAGCCACACCATCGGCGATTCCCGGTGCACGAGCTTCCGGCAGCGTCTGTACAACCAGACGGGCAACGGCCTCCCGGACTTCACACTGGACGCGTCCTACGCAGCGGCGC
TGCGCCCGCGCTGCCCCCGCTCCGGCGGCGACCAGAACCTCTTCTTCCTCGACCCCGTCACGCCCTTCAAGTTCGACAACCAGTACTACAAGAACATCCTCGCCAACCGCGGCCTGCTCG
CCTCCGACGAGGTCCTCCTCACCGGCAGCTCCGCCACCGCCGACCTCGTCAAGCTCTACGCCGCCAACCAGGACATCTTCTTCCAGCACTTCGCGCAGTCCATGGTCAAGATGGGCAACA
TCTCGCCGCTCACCGGGGCCGACGGCGAGATCAGGAAGCACTGCAGGAGGGTCAACCACAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGTGCAATGGCGGCCTTGGCCTTGGTGCCTCTCGCCGTTGCGGTTCTCTTCTCCTCCCTGCCGTCGTCGGCGGCGTCCCCTGTGCAGTGGGGGAAGCTGGACCCCCACTTCTAC
GACCACTCGTGCCCGCAGGCGCAGCAGATCGTGGCGTCCATCGTGGGGAAGGCGCACTACCAGGACCCCCGCATGGCCGCCTCCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAG
GGCTGCGACGCGTCGCTCCTGCTTGACAGCAGCGGGTCGATCGTGAGCGAGAAGCGGTCCAACCCCAACCGGGACTCGGCCAGGGGCTTCGAGGTCATCGACGAGATCAAGGCCGCCCTC
GAGGCTGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCAGCGCCCGCGACTCCACCGTCATG
ACCGGTGGGCCCGGGTGGATTGTGCCTCTGGGGCGTAGGGACTCACGC
GGCGCCAGCGTGCAGGGCTCCAACAACGATATCCCGGCACCCAACAACACCCTCCCCACCATCATCACCAAGTTCAAGCTCCAGGGCCTCGACATCGTCGACCTCGTCGCACTCCTCG
GT
AGCCACACCATCGGCGATTCCCGGTGCACGAGCTTCCGGCAGCGTCTGTACAACCAGACGGGCAACGGCCTCCCGGACTTCACACTGGACGCGTCCTACGCAGCGGCGCTGCGCCCGCGC
TGCCCCCGCTCCGGCGGCGACCAGAACCTCTTCTTCCTCGACCCCGTCACGCCCTTCAAGTTCGACAACCAGTACTACAAGAACATCCTCGCCAACCGCGGCCTGCTCGCCTCCGACGAG
GTCCTCCTCACCGGCAGCTCCGCCACCGCCGACCTCGTCAAGCTCTACGCCGCCAACCAGGACATCTTCTTCCAGCACTTCGCGCAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTC
ACCGGGGCCGACGGCGAGATCAGGAAGCACTGCAGGAGGGTCAACCACAAA

Retrieve as FASTA