1. Browse the Database
  2. View Redoxidase
Entry information : SiPrx162 (Si036621m)
Entry ID 9505
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx162 (Si036621m)
Name (synonym) SiPrx162 (Si036621m)
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx162
start..stop		 S start..stop
PviPrx02 608 0 1..326 1..325
ZmPrx105 600 0 1..326 37..362
ZmPrx142 586 0 1..325 1..326
SbPrx10 582 0 1..325 1..327
Gene structure Fichier Exons►


exon

Literature and cross-references SiPrx162 (Si036621m)
DNA ref. Phytozome 12:   scaffold_9 (36462815..36464893)
Protein sequence: SiPrx162 (Si036621m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (299)
PWM (Da):   %s   34887.45 (32309.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.38 (5.87) Peptide Signal:   %s   cut: 27 range:27-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQPARSAALLAAVAVVVLASAASCRGQLANNYYAGKCGNASVETIIQDAVKARLAWDKRMVAGLLHLQFHDCFVDGCDASILLDGPNTEKTAVQNSGIFGYDFIDDVKTALENVCPGVVS
CADIIIAATRDAVAMCGGPRYQVQLGRRDGMVSQASRASILPGPNVDIPTAISLFSKKNLNSFDMAILMGAHTVGVTHCSVIHDRLYDFNGTGLPDPGMDPLYVWILTTFACPKGQAFDN
IVYLDDPSSILLVDKSYYAQIMKRHGVLAVDQALGDHSSTAWMVNFLATTDFFPSMFSYALNKLAALDVLTGTAGEIRKNCRRTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST