Entry information : SiPrx167 (Si038861m)
Entry ID 9509
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx167 (Si038861m)
Name (synonym) SiPrx167 (Si038861m)
Class Class III peroxidase    [Orthogroup: Prx059]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx167
start..stop
S start..stop
SbPrx05 498 3e-179 30..333 33..338
ZmPrx113 489 1e-175 27..333 55..356
SpolPrx28 340 4e-117 1..332 7..326
EcamPrx74 335 4e-115 1..333 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12981259..12981471 213 N° 2 12980803..12981154 352 N° 3 12980248..12980681 434  
complement(join(12980248..12980681,12980803..12981154,12981259..12981471))


exon

Literature and cross-references SiPrx167 (Si038861m)
DNA ref. Phytozome 12:   scaffold_9 (12981471..12980248)
Protein sequence: SiPrx167 (Si038861m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (315)
PWM (Da):   %s   35733.53 (33898.5)  
PI (pH):   %s   9.21 (9.43) Peptide Signal:   %s   cut: 19 range:19-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALLLLLLALGAVQAADAVPPPSLQLQLGFYARSCPRAEAIVRRVVRRRAARDRSVLPALIRLHFHDCFVRGCDGSVLIDSTPGHPPAEKDAPPNLTLRMLDVIDDVKAAVEEACPGVVSCADVVALAARDAAAMAGRVRYDLPTGRRDGTVSSAAEVNLPSPSVSFSEALSAFRSIGLGVVDLTTLLGSHTMGFCHCGLIMNRLYNYNSTNPFDPSMDAGLLAVLRRRCPPHVVTPQNESRDVIVPMNFVAPLGPFGLDNSFYPSVLAGRAVLQIDQELASSGVARRIAAMFASRPGNFRRQFAKSMVKLGGVNVVTGRQGEVRLNCRRFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTGCTGCTGCTGCTGTTGGCGCTCGGCGCGGTGCAAGCCGCCGATGCCGTGCCGCCGCCGTCCCTGCAGCTGCAGCTCGGCTTCTACGCGCGGTCGTGCCCCCGCGCCGAGGCC
ATCGTCCGCCGCGTCGTTCGCCGCCGCGCCGCCCGCGACCGCTCCGTCCTCCCCGCGCTCATCCGCCTGCACTTCCACGACTGCTTCGTCAGG
GTACGCGTGTCATCGTCACTCGTCGGA
GACCGTCTCATCGGCCTTGTGTCACCTCTGACGCCAAGTGTCTGTCATGTTCATGTGTTACGACCTACCACTATCAGGGATGCGATGGCTCGGTGCTCATCGACAGCACGCCCGGCCACC
CGCCGGCCGAGAAGGATGCCCCGCCGAACCTGACGCTGAGGATGCTCGACGTGATCGACGACGTCAAGGCGGCCGTCGAGGAGGCGTGCCCGGGCGTCGTGTCGTGCGCCGACGTCGTCG
CGCTGGCCGCCAGGGACGCCGCGGCCATGGCGGGGAGGGTGCGCTACGACCTGCCCACGGGGAGAAGGGACGGCACCGTGTCCAGCGCCGCCGAGGTGAACCTGCCGAGCCCCTCCGTGT
CCTTCTCCGAAGCTCTGTCCGCCTTCCGCTCCATTGGCCTCGGGGTCGTTGATCTCACCACCTTGCTAG
GTCGTAACAAATTTTAATCAAAATGTGGCATATATTGTTCATCTGTTTTTG
TATCGAACATTTCAAACTAAATTTGTGGCATTTCTTACGCTCTTTTCTTGGAAAAAAATAAACGTGGCAGGTTCGCACACCATGGGGTTCTGCCACTGCGGGCTCATCATGAACAGGCTC
TACAACTACAACAGCACCAACCCGTTCGACCCGTCCATGGACGCCGGCCTGCTCGCCGTGCTCCGGCGCCGGTGTCCGCCGCACGTGGTTACGCCGCAGAACGAGTCGCGCGACGTGATC
GTGCCCATGAACTTCGTCGCGCCGCTCGGCCCCTTCGGCCTCGACAACTCCTTCTACCCGAGCGTGCTCGCCGGGAGGGCCGTCCTGCAGATCGACCAGGAGCTCGCGTCATCCGGCGTC
GCCCGCCGGATCGCGGCCATGTTCGCGTCGCGGCCGGGGAATTTCCGGAGGCAGTTCGCCAAGTCCATGGTGAAGCTTGGGGGCGTGAACGTCGTGACGGGGAGGCAAGGGGAGGTCAGG
CTCAACTGTCGACGGTTCAACAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTGCTGCTGCTGCTGTTGGCGCTCGGCGCGGTGCAAGCCGCCGATGCCGTGCCGCCGCCGTCCCTGCAGCTGCAGCTCGGCTTCTACGCGCGGTCGTGCCCCCGCGCCGAGGCC
ATCGTCCGCCGCGTCGTTCGCCGCCGCGCCGCCCGCGACCGCTCCGTCCTCCCCGCGCTCATCCGCCTGCACTTCCACGACTGCTTCGTCAGG
GGATGCGATGGCTCGGTGCTCATCGAC
AGCACGCCCGGCCACCCGCCGGCCGAGAAGGATGCCCCGCCGAACCTGACGCTGAGGATGCTCGACGTGATCGACGACGTCAAGGCGGCCGTCGAGGAGGCGTGCCCGGGCGTCGTGTCG
TGCGCCGACGTCGTCGCGCTGGCCGCCAGGGACGCCGCGGCCATGGCGGGGAGGGTGCGCTACGACCTGCCCACGGGGAGAAGGGACGGCACCGTGTCCAGCGCCGCCGAGGTGAACCTG
CCGAGCCCCTCCGTGTCCTTCTCCGAAGCTCTGTCCGCCTTCCGCTCCATTGGCCTCGGGGTCGTTGATCTCACCACCTTGCTAG
GTTCGCACACCATGGGGTTCTGCCACTGCGGGCTC
ATCATGAACAGGCTCTACAACTACAACAGCACCAACCCGTTCGACCCGTCCATGGACGCCGGCCTGCTCGCCGTGCTCCGGCGCCGGTGTCCGCCGCACGTGGTTACGCCGCAGAACGAG
TCGCGCGACGTGATCGTGCCCATGAACTTCGTCGCGCCGCTCGGCCCCTTCGGCCTCGACAACTCCTTCTACCCGAGCGTGCTCGCCGGGAGGGCCGTCCTGCAGATCGACCAGGAGCTC
GCGTCATCCGGCGTCGCCCGCCGGATCGCGGCCATGTTCGCGTCGCGGCCGGGGAATTTCCGGAGGCAGTTCGCCAAGTCCATGGTGAAGCTTGGGGGCGTGAACGTCGTGACGGGGAGG
CAAGGGGAGGTCAGGCTCAACTGTCGACGGTTCAACAGC

Retrieve as FASTA